DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18735 and prss60.1

DIOPT Version :9

Sequence 1:NP_652645.1 Gene:CG18735 / 59137 FlyBaseID:FBgn0042098 Length:364 Species:Drosophila melanogaster
Sequence 2:NP_001082915.1 Gene:prss60.1 / 799770 ZFINID:ZDB-GENE-070424-25 Length:387 Species:Danio rerio


Alignment Length:314 Identity:105/314 - (33%)
Similarity:159/314 - (50%) Gaps:32/314 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    74 CGNINTRHRIVGGQETEVHEYPWMIML--MWFGNFYCGASLVNDQYALTAAHCVNGFYHRLITVR 136
            ||.....:|||||.......:||.:.|  ..:|..:||.||:|.::.||||||:.......:.|.
Zfish    25 CGLAPLNNRIVGGVNAFDGSWPWQVSLHSPIYGGHFCGGSLINSEWVLTAAHCLPRITTSSLLVF 89

  Fly   137 LLEHNRQDSHVKIVDRRVSRVLIHPKYSTRNFDSDIALIRFNEPVRLGIDMHPVCMPTPSENYA- 200
            |.:..:|..:...::|.||.:.:||.|:....::||||:..:..|.....:.|||:...:..:. 
Zfish    90 LGKTTQQGVNTYEINRTVSVITVHPSYNNLTNENDIALLHLSSAVTFSNYIRPVCLAAQNSVFPN 154

  Fly   201 GQTAVVTGWGALSEGG--PISDTLQEVEVPILSQEECRNSNYGESKITDNMICAGYVEQGGKDSC 263
            |.::.:||||.:..|.  |....|||..:|::..::| |:..|...:|:||||||.: |||:|:|
Zfish   155 GTSSWITGWGNIQLGVNLPAPGILQETMIPVVPNDQC-NALLGSGSVTNNMICAGLL-QGGRDTC 217

  Fly   264 QGDSGGPMHVLGSGDAYQLAGIVSWGEGCAKPNAPGVYTRVGSFNDWIAE------------NTR 316
            |||||||| |......:..:||.|||.|||.|.:|||||||..:..||..            |:.
Zfish   218 QGDSGGPM-VSKQCLVWVQSGITSWGYGCADPYSPGVYTRVSQYQSWINSIIVQNLPGFVLFNSS 281

  Fly   317 DAC---------SCAQPEAAGEPASPMETTEQGDQENTTANGAAEADPEVEEAN 361
            ..|         |.|.|.::...|||..||   ..:.:|.:.|:...|...:.:
Zfish   282 STCSSVSMTLPNSTALPTSSISTASPTTTT---TTKISTISSASTKPPTTSQTS 332

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18735NP_652645.1 Tryp_SPc 82..311 CDD:214473 88/233 (38%)
Tryp_SPc 83..314 CDD:238113 89/247 (36%)
prss60.1NP_001082915.1 Tryp_SPc 33..264 CDD:214473 88/233 (38%)
Tryp_SPc 34..267 CDD:238113 89/235 (38%)
Somatomedin_B 349..382 CDD:295334
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170587887
Domainoid 1 1.000 191 1.000 Domainoid score I3175
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 201 1.000 Inparanoid score I3731
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - mtm6349
orthoMCL 1 0.900 - - OOG6_100031
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X11
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
76.790

Return to query results.
Submit another query.