DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18735 and egflam

DIOPT Version :9

Sequence 1:NP_652645.1 Gene:CG18735 / 59137 FlyBaseID:FBgn0042098 Length:364 Species:Drosophila melanogaster
Sequence 2:XP_009299464.1 Gene:egflam / 799405 -ID:- Length:1056 Species:Danio rerio


Alignment Length:235 Identity:48/235 - (20%)
Similarity:79/235 - (33%) Gaps:79/235 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly    20 ATPSLRSASDPEKILNNLAQLRQSSFLDWIQSILGP-----EVPAEWS-SPAKREC--------A 70
            |||.:|:|:.|..:.::     ..|...|    .|.     :||.|.: .||...|        :
Zfish   352 ATPIVRTATPPPAVPSS-----SPSMTPW----KGERARVYDVPCEETVCPADSFCINDYDTGGS 407

  Fly    71 ECSCGNINTRHRIVGGQETEVHEYPWMIMLMWFGNFYCGASLVNDQYALTAAHCVN-----GFYH 130
            .|.|.        :|.|                |:| |...|.           :|     |:.|
Zfish   408 RCHCN--------LGRQ----------------GDF-CSEGLT-----------INFPKFYGYSH 436

  Fly   131 RLITVRLLEHNRQDSHVKIVDRRVSR--VLIH---PKYSTRNFDSDIALIRFNEPVRLGIDMHPV 190
              :|...|:::.|...:.:..:..:.  :|::   .::...:|.| :||||.....|........
Zfish   437 --MTFEPLKNSYQSFQISLEFKAEAEDGLLLYCGENEHGRGDFTS-LALIRGKLHYRFNCGTGAA 498

  Fly   191 CMPTPSENYAGQTAVVT-------GWGALSEGGPISDTLQ 223
            .:.:.|....||...||       ||..|....|:|...|
Zfish   499 QIISDSSIVIGQWHTVTIFRDGMNGWLRLDNDTPVSSRSQ 538

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18735NP_652645.1 Tryp_SPc 82..311 CDD:214473 31/159 (19%)
Tryp_SPc 83..314 CDD:238113 31/158 (20%)
egflamXP_009299464.1 FN3 35..142 CDD:238020
FN3 151..237 CDD:238020
LamG 431..581 CDD:238058 24/111 (22%)
EGF_CA 600..642 CDD:238011
LamG 658..805 CDD:238058
EGF 828..858 CDD:278437
Laminin_G_2 908..1033 CDD:280389
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.