DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18735 and tmprss7

DIOPT Version :9

Sequence 1:NP_652645.1 Gene:CG18735 / 59137 FlyBaseID:FBgn0042098 Length:364 Species:Drosophila melanogaster
Sequence 2:XP_002666699.2 Gene:tmprss7 / 798480 ZFINID:ZDB-GENE-130530-883 Length:840 Species:Danio rerio


Alignment Length:268 Identity:101/268 - (37%)
Similarity:151/268 - (56%) Gaps:33/268 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    72 CSCG----------NINTRHRIVGGQETEVHEYPWMIMLMWFGNFYCGASLVNDQYALTAAHCVN 126
            |:||          ..:.:.|||||......|:||.:.:.:.|..|||||:::|.:.::||||.:
Zfish   581 CACGKPTHVKRVLDGTSPQQRIVGGVNAVEGEWPWQVSMHFSGQLYCGASVLSDVWLISAAHCYS 645

  Fly   127 GFYHRLITVRLLEHNRQDSHVKIVDR-------RVSRVLIHPKYSTRNFDSDIALIRFNEPVRLG 184
                   ..||.:.....:|:.::::       .:.|:::|..|:.||||.||||::..:....|
Zfish   646 -------KERLADPRMWMAHLGMLNQGSAKHVAEIRRIVVHEYYNARNFDYDIALLQLKKVWPSG 703

  Fly   185 IDMH--PVCMPTPSENYA-GQTAVVTGWGALSEGGPISDT-LQEVEVPILSQEECRNSNYGESKI 245
            ::.:  |||:|.||:.:. |....|||||..||...:..| ||:.||.:|||.||:.| ||  .:
Zfish   704 LEQYIQPVCLPAPSQTFTEGHRCWVTGWGYRSEQDKVLPTVLQKAEVNVLSQSECKRS-YG--PV 765

  Fly   246 TDNMICAGYVEQGGKDSCQGDSGGPMHVLG-SGDAYQLAGIVSWGEGCAKPNAPGVYTRVGSFND 309
            :..|:||| |..|.:|:|:||||||:.... :|..:.|.||||||.||.:|..|||||||..|.|
Zfish   766 SPRMLCAG-VPSGEQDACRGDSGGPLSCQAQTGSRWFLTGIVSWGSGCGRPYLPGVYTRVAKFID 829

  Fly   310 WIAENTRD 317
            ||..:..|
Zfish   830 WIQRHIHD 837

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18735NP_652645.1 Tryp_SPc 82..311 CDD:214473 95/240 (40%)
Tryp_SPc 83..314 CDD:238113 96/242 (40%)
tmprss7XP_002666699.2 SEA 99..203 CDD:307516
CUB <260..344 CDD:238001
CUB 367..465 CDD:294042
LDLa 472..506 CDD:238060
LDLa 546..581 CDD:238060 101/268 (38%)
Tryp_SPc 601..831 CDD:214473 95/240 (40%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.