DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18735 and mettl7a.2

DIOPT Version :9

Sequence 1:NP_652645.1 Gene:CG18735 / 59137 FlyBaseID:FBgn0042098 Length:364 Species:Drosophila melanogaster
Sequence 2:XP_002933742.3 Gene:mettl7a.2 / 779612 XenbaseID:XB-GENE-22069551 Length:244 Species:Xenopus tropicalis


Alignment Length:59 Identity:13/59 - (22%)
Similarity:17/59 - (28%) Gaps:20/59 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly   271 MHVLGSGDAYQL-----AGIVSW---------------GEGCAKPNAPGVYTRVGSFND 309
            :.||..|.||..     |...||               |:||........|.....|::
 Frog   161 LRVLKPGGAYYFLEHVRADSASWNYFFQRILDPTWKYIGDGCKLTKETWKYLESSKFSE 219

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18735NP_652645.1 Tryp_SPc 82..311 CDD:214473 13/59 (22%)
Tryp_SPc 83..314 CDD:238113 13/59 (22%)
mettl7a.2XP_002933742.3 Methyltransf_11 75..172 CDD:400514 5/10 (50%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.