powered by:
Protein Alignment CG18735 and mettl7a.2
DIOPT Version :9
Sequence 1: | NP_652645.1 |
Gene: | CG18735 / 59137 |
FlyBaseID: | FBgn0042098 |
Length: | 364 |
Species: | Drosophila melanogaster |
Sequence 2: | XP_002933742.3 |
Gene: | mettl7a.2 / 779612 |
XenbaseID: | XB-GENE-22069551 |
Length: | 244 |
Species: | Xenopus tropicalis |
Alignment Length: | 59 |
Identity: | 13/59 - (22%) |
Similarity: | 17/59 - (28%) |
Gaps: | 20/59 - (33%) |
- Green bases have known domain annotations that are detailed below.
Fly 271 MHVLGSGDAYQL-----AGIVSW---------------GEGCAKPNAPGVYTRVGSFND 309
:.||..|.||.. |...|| |:||........|.....|::
Frog 161 LRVLKPGGAYYFLEHVRADSASWNYFFQRILDPTWKYIGDGCKLTKETWKYLESSKFSE 219
|
Known Domains:
Indicated by green bases in alignment.
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
0 | 0.000 |
Not matched by this tool. |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
1 |
0.910 |
- |
- |
|
|
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
|
1 | 0.910 |
|
Return to query results.
Submit another query.