DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18735 and st14b

DIOPT Version :9

Sequence 1:NP_652645.1 Gene:CG18735 / 59137 FlyBaseID:FBgn0042098 Length:364 Species:Drosophila melanogaster
Sequence 2:XP_005161261.1 Gene:st14b / 777629 ZFINID:ZDB-GENE-061103-613 Length:864 Species:Danio rerio


Alignment Length:276 Identity:112/276 - (40%)
Similarity:162/276 - (58%) Gaps:16/276 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly    51 SILGPEVPAEWSSPAKRECAECSCG-NINTRHRIVGGQETEVHEYPWMIML-MWFGNFYCGASLV 113
            |.|.|....|.......:.|||.|| ..:...|||||::::..|:||.:.| |......||||::
Zfish   592 SKLNPMCDGETDCVDGSDEAECKCGKKPHKSSRIVGGKDSDEGEWPWQVSLHMKTQGHVCGASVI 656

  Fly   114 NDQYALTAAHCV---NGFYHRLI---TVRLLEHNRQDSHVKIVDRRVSRVLIHPKYSTRNFDSDI 172
            ::.:.:||||||   :.|.:...   .|.|..||:.::. |...|.|.|::.||:|...::|:||
Zfish   657 SNSWLVTAAHCVQDNDQFRYSQADQWEVYLGLHNQGETS-KSTQRSVLRIIPHPQYDHSSYDNDI 720

  Fly   173 ALIRFNEPVRLGIDMHPVCMPTPSENY-AGQTAVVTGWGALSEGG-PISDTLQEVEVPILSQEEC 235
            ||:..:.||.|..::.|:|:|.|:..: ||::..:||||.|.||. .:...||:.||.|::...|
Zfish   721 ALMELDSPVTLNQNIWPICLPDPTHYFPAGKSVWITGWGKLREGSDAVPSVLQKAEVRIINSTVC 785

  Fly   236 RNSNYGESKITDNMICAGYVEQGGKDSCQGDSGGPM-HVLGSGDAYQLAGIVSWGEGCAKPNAPG 299
              |...:..||.:||||| |..||.|:||||||||| .:.|:|..: |||:||||:||.:.|.||
Zfish   786 --SKLMDDGITPHMICAG-VLSGGVDACQGDSGGPMSSIEGNGRMF-LAGVVSWGDGCGRRNRPG 846

  Fly   300 VYTRVGSFNDWIAENT 315
            |||||..:..||.|.|
Zfish   847 VYTRVTDYRSWIREIT 862

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18735NP_652645.1 Tryp_SPc 82..311 CDD:214473 99/238 (42%)
Tryp_SPc 83..314 CDD:238113 100/240 (42%)
st14bXP_005161261.1 SEA 92..180 CDD:279699
CUB 233..342 CDD:238001
CUB 351..457 CDD:238001
LDLa 465..497 CDD:238060
LDLa 499..533 CDD:238060
LDLa 536..570 CDD:238060
LDLa 578..613 CDD:238060 5/20 (25%)
Tryp_SPc 624..858 CDD:214473 99/238 (42%)
Tryp_SPc 625..861 CDD:238113 100/240 (42%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - mtm6416
orthoMCL 1 0.900 - - OOG6_100031
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X11
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
43.810

Return to query results.
Submit another query.