DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18735 and Prss36

DIOPT Version :9

Sequence 1:NP_652645.1 Gene:CG18735 / 59137 FlyBaseID:FBgn0042098 Length:364 Species:Drosophila melanogaster
Sequence 2:XP_017167884.1 Gene:Prss36 / 77613 MGIID:1924863 Length:863 Species:Mus musculus


Alignment Length:360 Identity:119/360 - (33%)
Similarity:168/360 - (46%) Gaps:59/360 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    45 FLDWIQSILGPEVPAEWS----SPAKRECAECSCGNINTRHRIVGGQETEVHEYPWMIMLMWFGN 105
            ||..:..::.|..|..:.    ||.:.|..:..||......|||||.:.....:||.:.|...|.
Mouse     6 FLPVVIMVVSPIPPGAFQDSVVSPTQGEFEDLDCGRPEPSSRIVGGSDAHPGTWPWQVSLHQGGG 70

  Fly   106 FYCGASLVNDQYALTAAHC--VNGFYHRL--ITVRLLEHNR----QDSHVKIVDRRVSRVLIHPK 162
            ..||.||:...:.|:||||  .||.....  ::|.|..|::    :.:|:    |.|:.:||...
Mouse    71 HICGGSLIAPSWVLSAAHCFVTNGTLEPADELSVLLGVHSQDGPLEGAHM----RSVATILIPDN 131

  Fly   163 YSTRNFDSDIALIRFNEPVRLGIDMHPVCMPTPSENYAGQTAV-VTGWGALSEGG--PISDTLQE 224
            |||....:|:||:|...|.:||..:.|||:|..|..:|..||. .||||.:.|..  |:...|||
Mouse   132 YSTVELGADLALLRLASPAKLGPSVRPVCLPRASHLFAHGTACWATGWGDVQEAVPLPLPWVLQE 196

  Fly   225 VEVPILSQE--ECRNSNYGESKIT----DNMICAGYVEQGGKDSCQGDSGGPMHVLGSGDAYQLA 283
            ||:.:|.:.  :|..|..|...:|    ..|:|||| ..|.:|:||||||||: |...|..:.||
Mouse   197 VELRLLGEAACQCLYSRPGPFNLTFQLLPGMLCAGY-PAGRRDTCQGDSGGPL-VCEDGGRWFLA 259

  Fly   284 GIVSWGEGCAKPNAPGVYTRVGSFNDWIAENT------------------------RDACSCAQP 324
            ||.|:|.||.:.|.|||:|.|..:..||.|:.                        .:.|:.|||
Mouse   260 GITSFGFGCGRRNRPGVFTAVAPYESWIREHVMGSEPGPVFPSQLQKPQSGPWEPREENCTFAQP 324

  Fly   325 EAAGEPAS---PME--TTEQGDQENTTANGAAEAD 354
            |....|..   |.|  .|..|   :|...||..:|
Mouse   325 ECGKAPRPGTWPWEAQVTVPG---STPCYGALVSD 356

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18735NP_652645.1 Tryp_SPc 82..311 CDD:214473 93/245 (38%)
Tryp_SPc 83..314 CDD:238113 94/247 (38%)
Prss36XP_017167884.1 Tryp_SPc 48..290 CDD:238113 94/247 (38%)
Tryp_SPc 331..532 CDD:389826 8/29 (28%)
Tryp_SPc 607..789 CDD:389826
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100031
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.