DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18735 and XB5723326

DIOPT Version :9

Sequence 1:NP_652645.1 Gene:CG18735 / 59137 FlyBaseID:FBgn0042098 Length:364 Species:Drosophila melanogaster
Sequence 2:NP_001037931.1 Gene:XB5723326 / 733551 XenbaseID:XB-GENE-5723327 Length:349 Species:Xenopus tropicalis


Alignment Length:331 Identity:81/331 - (24%)
Similarity:140/331 - (42%) Gaps:76/331 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    73 SCGNINTRHRIVGGQETEVH----EYPWMIML---MWFG-NFYCGASLVNDQYALTAAHC----- 124
            :|||......:.....||::    ::||::.:   :..| ...|..:::|:::.:|||||     
 Frog     2 ACGNRPFYTEVKASYSTELNPVEGKWPWIVSIQKKVELGYKHICAGTILNNEWIITAAHCFKDWK 66

  Fly   125 -----------VNGFYHRLITVRLLEHNRQDSHVKIVDRRVSRVLIHPKYSTRNFDSDIALIRFN 178
                       :..||...|.:|            ...|.|.:::.|.:|......:|||||:.:
 Frog    67 EGDPTTPLRVLLGTFYLSEIGLR------------TQSRGVKQLIKHDQYDPITESNDIALIQLD 119

  Fly   179 EPVRLGIDMHPVCMPTPSENYAGQ-TAVVTGWGA----LSEGGPISDTLQEVEVPILSQEECRNS 238
            :.|.....:...|.|..|.:.... ...:.||||    |.|.   |..|||.:|..:..:.|  :
 Frog   120 KQVEFSDHIQQACFPKESADLKDLIDCSIAGWGAQGKHLDEP---SQFLQEAQVERIDTKHC--N 179

  Fly   239 NYGESKITDNMICAGYVEQGGKDSCQGDSGGP-MHVLGSGDAYQLAGIVSWGEGCAKPNAPGVYT 302
            .:.:..:.:|.:|||: .:|.:.:|.||.|.| |......:.|.:.||::||.||.:..:||||:
 Frog   180 KWYQGILGENHLCAGH-RKGPEKTCNGDRGSPLMCRTKKNNVYSVIGILNWGSGCGQTRSPGVYS 243

  Fly   303 RVGSFNDWIAENTRDACSCAQPEAAGEPASPMETTEQG--------------DQENTTANGAAEA 353
            .:.|...||.|..::       ||       ::.|.||              |..|...|.|..:
 Frog   244 PIQSHIKWIVEKVKN-------EA-------VKATIQGKRLVPKLLFPLVKPDHMNPNRNTAQNS 294

  Fly   354 DPEVEE 359
            :.|::|
 Frog   295 EAEIKE 300

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18735NP_652645.1 Tryp_SPc 82..311 CDD:214473 64/258 (25%)
Tryp_SPc 83..314 CDD:238113 66/260 (25%)
XB5723326NP_001037931.1 Tryp_SPc 25..252 CDD:214473 62/244 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X11
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.