DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18735 and TPSAB1

DIOPT Version :9

Sequence 1:NP_652645.1 Gene:CG18735 / 59137 FlyBaseID:FBgn0042098 Length:364 Species:Drosophila melanogaster
Sequence 2:NP_003285.2 Gene:TPSAB1 / 7177 HGNCID:12019 Length:275 Species:Homo sapiens


Alignment Length:263 Identity:103/263 - (39%)
Similarity:147/263 - (55%) Gaps:24/263 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly    65 AKRECAECSCGNINTRHRIVGGQETEVHEYPWMIMLMWFGNF---YCGASLVNDQYALTAAHCVN 126
            |.|..|..:.|....|..||||||....::||.:.|...|.:   :||.||::.|:.|||||||.
Human    13 ASRAYAAPAPGQALQRVGIVGGQEAPRSKWPWQVSLRVHGPYWMHFCGGSLIHPQWVLTAAHCVG 77

  Fly   127 GFYHRLITVRLLEHNRQDSHVKIVDR--RVSRVLIHPKYSTRNFDSDIALIRFNEPVRLGIDMHP 189
            .....|..:|:   ..::.|:...|:  .|||:::||::.|....:||||:...|||.:...:|.
Human    78 PDVKDLAALRV---QLREQHLYYQDQLLPVSRIIVHPQFYTAQIGADIALLELEEPVNVSSHVHT 139

  Fly   190 VCMPTPSENY-AGQTAVVTGWGAL--SEGGPISDTLQEVEVPILSQEECRNSNY------GESK- 244
            |.:|..||.: .|....|||||.:  .|..|....|::|:|||:....| ::.|      |:.. 
Human   140 VTLPPASETFPPGMPCWVTGWGDVDNDERLPPPFPLKQVKVPIMENHIC-DAKYHLGAYTGDDVR 203

  Fly   245 -ITDNMICAGYVEQGGKDSCQGDSGGPMHVLGSGDAYQLAGIVSWGEGCAKPNAPGVYTRVGSFN 308
             :.|:|:|||...   :||||||||||:....:|...| ||:||||||||:||.||:||||..:.
Human   204 IVRDDMLCAGNTR---RDSCQGDSGGPLVCKVNGTWLQ-AGVVSWGEGCAQPNRPGIYTRVTYYL 264

  Fly   309 DWI 311
            |||
Human   265 DWI 267

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18735NP_652645.1 Tryp_SPc 82..311 CDD:214473 96/244 (39%)
Tryp_SPc 83..314 CDD:238113 98/245 (40%)
TPSAB1NP_003285.2 Tryp_SPc 31..268 CDD:238113 98/245 (40%)
Tryp_SPc 31..267 CDD:214473 96/243 (40%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165152899
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X11
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.840

Return to query results.
Submit another query.