DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18735 and Prss41

DIOPT Version :9

Sequence 1:NP_652645.1 Gene:CG18735 / 59137 FlyBaseID:FBgn0042098 Length:364 Species:Drosophila melanogaster
Sequence 2:XP_036016678.1 Gene:Prss41 / 71003 MGIID:1918253 Length:353 Species:Mus musculus


Alignment Length:279 Identity:95/279 - (34%)
Similarity:139/279 - (49%) Gaps:40/279 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    64 PAKRECAECS-------------CGNIN-TRHRIVGGQETEVHEYPWMIMLMWFGNFYCGASLVN 114
            |..||.::.:             ||..| ||.|||||.|:....:||...|....:..||.||::
Mouse    51 PGSREESQAADLKSTDIKLLSMPCGRRNDTRSRIVGGIESMQGRWPWQASLRLKKSHRCGGSLLS 115

  Fly   115 DQYALTAAHCVNGFYH-RLITVRLLEHNRQDSHVKIVDR-------RVSRVLIHPKYSTRNFDSD 171
            .::.||||||...:.. ...||:|.:...:.|:   .:|       ||..::::.:...::  .|
Mouse   116 RRWVLTAAHCFRKYLDPEKWTVQLGQLTSKPSY---WNRKAYSGRYRVKDIIVNSEDKLKS--HD 175

  Fly   172 IALIRFNEPVRLGIDMHPVCM-PTPSENYAGQTAVVTGWGALSEG-GPISDT--LQEVEVPILSQ 232
            :||:|....|....|:.|||: |:...:.......|||||.|.|. .|:...  |:||:|.||:.
Mouse   176 LALLRLASSVTYNKDIQPVCVQPSTFTSQHQPRCWVTGWGVLQEDLKPLPPPYHLREVQVSILNN 240

  Fly   233 EECRN-----SNYGESKITDNMICAGYVEQGGKDSCQGDSGGPMHVLGSGDAYQLAGIVSWGEGC 292
            ..|:.     |.:  ..||.::.||| .|.|..|:|.||||||:.....|..||: ||||||.||
Mouse   241 SRCQELFEIFSLH--HLITKDVFCAG-AEDGSADTCSGDSGGPLVCNMDGLWYQI-GIVSWGIGC 301

  Fly   293 AKPNAPGVYTRVGSFNDWI 311
            .:||.||:||.|..:.:||
Mouse   302 GRPNLPGIYTNVSHYYNWI 320

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18735NP_652645.1 Tryp_SPc 82..311 CDD:214473 85/245 (35%)
Tryp_SPc 83..314 CDD:238113 86/246 (35%)
Prss41XP_036016678.1 Tryp_SPc 84..321 CDD:238113 86/246 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.