DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18735 and Prss32

DIOPT Version :9

Sequence 1:NP_652645.1 Gene:CG18735 / 59137 FlyBaseID:FBgn0042098 Length:364 Species:Drosophila melanogaster
Sequence 2:NP_081496.2 Gene:Prss32 / 69814 MGIID:1917064 Length:334 Species:Mus musculus


Alignment Length:284 Identity:107/284 - (37%)
Similarity:153/284 - (53%) Gaps:25/284 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly    52 ILGPEV-PAEWSSPA----KREC-AECSCGNINTRHRIVGGQETEVHEYPWMIMLMWFGNFYCGA 110
            :||.|| |.:..||:    :|.. .:..||...|..|||.||:.::..:||.:.:...|...||.
Mouse    17 LLGSEVLPTDSDSPSTTTGRRSIDLDSVCGRPRTSGRIVSGQDAQLGRWPWQVSVRENGAHVCGG 81

  Fly   111 SLVNDQYALTAAHCVN-GFYHRLITVRL--LEHNRQDSHVKIVDRRVSRVLIHPKYSTRNFDS-D 171
            ||:.:.:.||||||.| |....:.||.|  :....:|:..|.: |.|::.:.||.||.....| |
Mouse    82 SLIAEDWVLTAAHCFNQGQSLSIYTVLLGTISSYPEDNEPKEL-RAVAQFIKHPSYSADEHSSGD 145

  Fly   172 IALIRFNEPVRLGIDMHPVCMPTPSENY-AGQTAVVTGWGALSEGGPISD--TLQEVEVPILSQE 233
            |||::...|:.....|.|||:|.|.:.. .|....|||||.:....|:..  ||||::||::..|
Mouse   146 IALVQLASPISFNDYMLPVCLPKPGDPLDPGTMCWVTGWGHIGTNQPLPPPFTLQELQVPLIDAE 210

  Fly   234 ECRNSNYGESK-------ITDNMICAGYVEQGGKDSCQGDSGGPMHVLGSGDAYQLAGIVSWGEG 291
            .| |:.|.|:.       |.:.|:|||: ::|.||:|.||||||: |....|.:..||:||||..
Mouse   211 TC-NTYYQENSIPGTEPVILEGMLCAGF-QEGKKDACNGDSGGPL-VCDINDVWIQAGVVSWGSD 272

  Fly   292 CAKPNAPGVYTRVGSFNDWIAENT 315
            ||....|||||.|..:..|| :||
Mouse   273 CALFKRPGVYTNVSVYISWI-QNT 295

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18735NP_652645.1 Tryp_SPc 82..311 CDD:214473 92/242 (38%)
Tryp_SPc 83..314 CDD:238113 93/244 (38%)
Prss32NP_081496.2 Tryp_SPc 53..292 CDD:214473 92/242 (38%)
Tryp_SPc 54..295 CDD:238113 93/245 (38%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100031
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X11
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
43.810

Return to query results.
Submit another query.