DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18735 and LOC683849

DIOPT Version :9

Sequence 1:NP_652645.1 Gene:CG18735 / 59137 FlyBaseID:FBgn0042098 Length:364 Species:Drosophila melanogaster
Sequence 2:XP_003749780.1 Gene:LOC683849 / 683849 RGDID:1597830 Length:246 Species:Rattus norvegicus


Alignment Length:238 Identity:99/238 - (41%)
Similarity:144/238 - (60%) Gaps:25/238 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    82 RIVGGQETEVHEYPWMIMLMWFGNFYCGASLVNDQYALTAAHCVNGFYHRLITVRLLEHNRQDSH 146
            :||||...:.:..|:.:.|. .|..:||.||:|||:.::||||    |...|.|||.|||     
  Rat    23 KIVGGYTCQENSVPYQVSLN-SGYHFCGGSLINDQWVVSAAHC----YKSRIQVRLGEHN----- 77

  Fly   147 VKIVDR-----RVSRVLIHPKYSTRNFDSDIALIRFNEPVRLGIDMHPVCMPTPSENYAGQTAVV 206
            :.:::.     ..::::.||.:..:..::||.||:.:.||:|...:..|.:|: |...||...::
  Rat    78 INVLEGNEQFVNAAKIIKHPNFDRKTLNNDIMLIKLSSPVKLNARVATVALPS-SCAPAGTQCLI 141

  Fly   207 TGWG-ALSEGGPISDTLQEVEVPILSQEECRNSNYGESKITDNMICAGYVEQGGKDSCQGDSGGP 270
            :||| .||.|....|.||.::.|:|.|.:|..|..|  ||||||:|||::| |||||||||||||
  Rat   142 SGWGNTLSFGVNEPDLLQCLDAPLLPQADCEASYPG--KITDNMVCAGFLE-GGKDSCQGDSGGP 203

  Fly   271 MHVLGSGDAYQLAGIVSWGEGCAKPNAPGVYTRVGSFNDWIAE 313
            :...|     :|.||||||.|||.|:.|||||:|.::.|||.:
  Rat   204 VVCNG-----ELQGIVSWGYGCALPDNPGVYTKVCNYVDWIED 241

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18735NP_652645.1 Tryp_SPc 82..311 CDD:214473 97/234 (41%)
Tryp_SPc 83..314 CDD:238113 99/237 (42%)
LOC683849XP_003749780.1 Tryp_SPc 23..239 CDD:214473 97/234 (41%)
Tryp_SPc 24..242 CDD:238113 99/237 (42%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100031
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
43.810

Return to query results.
Submit another query.