DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18735 and Prss41

DIOPT Version :9

Sequence 1:NP_652645.1 Gene:CG18735 / 59137 FlyBaseID:FBgn0042098 Length:364 Species:Drosophila melanogaster
Sequence 2:NP_001128559.1 Gene:Prss41 / 681033 RGDID:1584711 Length:324 Species:Rattus norvegicus


Alignment Length:328 Identity:107/328 - (32%)
Similarity:146/328 - (44%) Gaps:69/328 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 LLLILATALGDLACATPSLRSASDPEKILNNLAQLRQSSFLDWIQSILGPEVPAEWSSPAKRECA 70
            |||::...||:     |..|..       |..|.|:.:.    |:.:..|               
  Rat    11 LLLVVCVMLGE-----PGSREE-------NQAAGLKNTD----IKLLSMP--------------- 44

  Fly    71 ECSCGNIN-TRHRIVGGQETEVHEYPWMIMLMWFGNFYCGASLVNDQYALTAAHCVNGFYH-RLI 133
               ||..| .|.|||||.|:....:||...|.......||.||::.::.||||||...|.. :..
  Rat    45 ---CGRRNDIRSRIVGGIESVRGRWPWQASLRLRKFHRCGGSLLSHRWVLTAAHCFRKFLDPKKW 106

  Fly   134 TVRLLEHNRQDSHVKIVDR-------RVSRVLIHP----KYSTRNFDSDIALIRFNEPVRLGIDM 187
            ||:|   .:..|.....:|       ||..::|:.    ||      .|:||:|....|.....:
  Rat   107 TVQL---GQLTSKPSFWNREAFSGRYRVKDIIINSEDKLKY------HDLALLRLASSVTYNKFI 162

  Fly   188 HPVC-MPTPSENYAGQTAVVTGWGALSEG-GPISDT--LQEVEVPILSQEECRN-----SNYGES 243
            .||| :|:.|.:.......|||||||.|. .|:...  |:||:|.:|:...|:.     |.|  .
  Rat   163 QPVCVLPSASMSQHQPRCWVTGWGALQEDLKPLPPPYHLREVQVTVLNLSRCQELFSFASRY--H 225

  Fly   244 KITDNMICAGYVEQGGKDSCQGDSGGPMHVLGSGDAYQLAGIVSWGEGCAKPNAPGVYTRVGSFN 308
            .||.::.||| .|.|..|:|.||||||:.....|..||: ||||.|.||.:|..||:||.|....
  Rat   226 LITRDVFCAG-AEDGSADTCSGDSGGPLVCNMDGLWYQI-GIVSRGVGCGRPKLPGIYTNVSHHY 288

  Fly   309 DWI 311
            |||
  Rat   289 DWI 291

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18735NP_652645.1 Tryp_SPc 82..311 CDD:214473 89/249 (36%)
Tryp_SPc 83..314 CDD:238113 90/250 (36%)
Prss41NP_001128559.1 Tryp_SPc 54..291 CDD:214473 89/249 (36%)
Tryp_SPc 55..292 CDD:238113 90/250 (36%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.