DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18735 and st14a

DIOPT Version :9

Sequence 1:NP_652645.1 Gene:CG18735 / 59137 FlyBaseID:FBgn0042098 Length:364 Species:Drosophila melanogaster
Sequence 2:NP_001035441.2 Gene:st14a / 678603 ZFINID:ZDB-GENE-030131-6496 Length:834 Species:Danio rerio


Alignment Length:260 Identity:102/260 - (39%)
Similarity:146/260 - (56%) Gaps:24/260 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly    70 AECSCG-NINTRHRIVGGQETEVHEYPWMIMLMWFGNF--YCGASLVNDQYALTAAHCVN----- 126
            :.|:|| ....:.||||||:....|:||.:.| ...|.  .||.|::|:::.:||||||.     
Zfish   583 SNCNCGTKAYKKSRIVGGQDAFEGEFPWQVSL-HIKNIAHVCGGSIINERWIVTAAHCVQDDVKI 646

  Fly   127 -----GFYHRLITVRLLEHNRQDSHVKIVDRRVSRVLIHPKYSTRNFDSDIALIRFNEPVRLGID 186
                 |.:.    |.|..|:::|. :....|.:.:|:.||.|:...:|:||||:....||.....
Zfish   647 KYSQPGTWE----VFLGLHSQKDK-LTATKRLLKQVIPHPYYNAYTYDNDIALMEMESPVTFSDT 706

  Fly   187 MHPVCMPTPSENY-AGQTAVVTGWGALSEGGPISDTLQEVEVPILSQEECRNSNYGESKITDNMI 250
            :.|||:||.::.: ||.:..::||||..|||..:..||:.||.|::...|.....|:  ||..|.
Zfish   707 IRPVCLPTATDTFPAGTSVFISGWGATREGGSGATVLQKAEVRIINSTVCNQLMGGQ--ITSRMT 769

  Fly   251 CAGYVEQGGKDSCQGDSGGPMHVLGSGDAYQLAGIVSWGEGCAKPNAPGVYTRVGSFNDWIAENT 315
            ||| |..||.|:||||||||:. ..||....|||:||||:|||:.|.||:|:.|..|..||.|.|
Zfish   770 CAG-VLSGGVDACQGDSGGPLS-FPSGKRMFLAGVVSWGDGCARRNKPGIYSNVPKFRAWIKEKT 832

  Fly   316  315
            Zfish   833  832

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18735NP_652645.1 Tryp_SPc 82..311 CDD:214473 95/241 (39%)
Tryp_SPc 83..314 CDD:238113 96/243 (40%)
st14aNP_001035441.2 SEA 77..168 CDD:279699
CUB 219..322 CDD:238001
CUB 329..431 CDD:238001
LDLa 443..472 CDD:238060
LDLa 474..508 CDD:238060
LDLa 510..544 CDD:238060
LDLa 550..585 CDD:238060 0/1 (0%)
Tryp_SPc 596..828 CDD:214473 95/241 (39%)
Tryp_SPc 597..831 CDD:238113 96/243 (40%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100031
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X11
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.