DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18735 and ST14

DIOPT Version :9

Sequence 1:NP_652645.1 Gene:CG18735 / 59137 FlyBaseID:FBgn0042098 Length:364 Species:Drosophila melanogaster
Sequence 2:NP_068813.1 Gene:ST14 / 6768 HGNCID:11344 Length:855 Species:Homo sapiens


Alignment Length:268 Identity:104/268 - (38%)
Similarity:153/268 - (57%) Gaps:22/268 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly    66 KRECA------ECSCG--NINTRHRIVGGQETEVHEYPWMIMLMWFGNFY-CGASLVNDQYALTA 121
            |.:|:      :|.||  :...:.|:|||.:.:..|:||.:.|...|..: |||||::..:.::|
Human   590 KEDCSDGSDEKDCDCGLRSFTRQARVVGGTDADEGEWPWQVSLHALGQGHICGASLISPNWLVSA 654

  Fly   122 AHCV---NGFYH---RLITVRLLEHNR-QDSHVKIVDRRVSRVLIHPKYSTRNFDSDIALIRFNE 179
            |||.   .||.:   ...|..|..|:: |.|...:.:||:.|::.||.::...||.||||:...:
Human   655 AHCYIDDRGFRYSDPTQWTAFLGLHDQSQRSAPGVQERRLKRIISHPFFNDFTFDYDIALLELEK 719

  Fly   180 PVRLGIDMHPVCMPTPSENY-AGQTAVVTGWGALSEGGPISDTLQEVEVPILSQEECRNSNYGES 243
            |......:.|:|:|..|..: ||:...|||||....||..:..||:.|:.:::|..|  .|....
Human   720 PAEYSSMVRPICLPDASHVFPAGKAIWVTGWGHTQYGGTGALILQKGEIRVINQTTC--ENLLPQ 782

  Fly   244 KITDNMICAGYVEQGGKDSCQGDSGGPM-HVLGSGDAYQLAGIVSWGEGCAKPNAPGVYTRVGSF 307
            :||..|:|.|:: .||.||||||||||: .|...|..:| ||:||||:|||:.|.||||||:..|
Human   783 QITPRMMCVGFL-SGGVDSCQGDSGGPLSSVEADGRIFQ-AGVVSWGDGCAQRNKPGVYTRLPLF 845

  Fly   308 NDWIAENT 315
            .|||.|||
Human   846 RDWIKENT 853

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18735NP_652645.1 Tryp_SPc 82..311 CDD:214473 94/238 (39%)
Tryp_SPc 83..314 CDD:238113 95/240 (40%)
ST14NP_068813.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..20
SEA 88..>171 CDD:307516
CUB 227..332 CDD:238001
CUB 340..444 CDD:238001
LDLa 454..486 CDD:238060
LDLa 488..523 CDD:238060
LDLa 525..559 CDD:238060
LDLa 567..602 CDD:238060 2/11 (18%)
Tryp_SPc 615..852 CDD:238113 95/240 (40%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100031
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R3952
SonicParanoid 1 1.000 - - X11
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
43.840

Return to query results.
Submit another query.