DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18735 and 2210010C04Rik

DIOPT Version :9

Sequence 1:NP_652645.1 Gene:CG18735 / 59137 FlyBaseID:FBgn0042098 Length:364 Species:Drosophila melanogaster
Sequence 2:NP_075822.3 Gene:2210010C04Rik / 67373 MGIID:1914623 Length:247 Species:Mus musculus


Alignment Length:237 Identity:95/237 - (40%)
Similarity:134/237 - (56%) Gaps:23/237 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly    82 RIVGGQETEVHEYPWMIMLMWFGNFYCGASLVNDQYALTAAHCVNGFYHRLITVRLLEHN--RQD 144
            :||||...:.:..|:.:.|. .|..:||.||:|.|:.::||||    |...|.|||.|||  ..:
Mouse    24 KIVGGYTCQRNALPYQVSLN-SGYHFCGGSLINSQWVVSAAHC----YKSRIQVRLGEHNIDALE 83

  Fly   145 SHVKIVDRRVSRVLIHPKYSTRNFDSDIALIRFNEPVRLGIDMHPVCMP--TPSENYAGQTAVVT 207
            ...:.:|  .::::.||.|:...:::||.||:......|...:..|.:|  .||   ||...:|:
Mouse    84 GGEQFID--AAKIIRHPNYNANTYNNDIMLIKLKTAATLNSRVSTVALPRSCPS---AGTRCLVS 143

  Fly   208 GWG-ALSEGGPISDTLQEVEVPILSQEECRNSNYGESKITDNMICAGYVEQGGKDSCQGDSGGPM 271
            ||| .||.|......||.::.|:||...|.:|..|  |||.||.|.|::| |||||||||||||:
Mouse   144 GWGNTLSSGTNYPSLLQCLDAPVLSDSSCTSSYPG--KITSNMFCLGFLE-GGKDSCQGDSGGPV 205

  Fly   272 HVLGSGDAYQLAGIVSWGEGCAKPNAPGVYTRVGSFNDWIAE 313
            ...|     ||.|:||||.|||:...|||||:|..:.:||.:
Mouse   206 VCNG-----QLQGVVSWGYGCAQRGKPGVYTKVCKYVNWIQQ 242

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18735NP_652645.1 Tryp_SPc 82..311 CDD:214473 93/233 (40%)
Tryp_SPc 83..314 CDD:238113 95/236 (40%)
2210010C04RikNP_075822.3 Tryp_SPc 24..240 CDD:214473 93/233 (40%)
Tryp_SPc 25..243 CDD:238113 95/236 (40%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100031
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.