DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18735 and prss1

DIOPT Version :9

Sequence 1:NP_652645.1 Gene:CG18735 / 59137 FlyBaseID:FBgn0042098 Length:364 Species:Drosophila melanogaster
Sequence 2:NP_571783.2 Gene:prss1 / 65223 ZFINID:ZDB-GENE-010131-7 Length:247 Species:Danio rerio


Alignment Length:243 Identity:91/243 - (37%)
Similarity:139/243 - (57%) Gaps:26/243 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    82 RIVGGQETEVHEYPWMIMLMWFGNFYCGASLVNDQYALTAAHCVNGFYHRLITVRLLEHNRQDSH 146
            :||||.|...:..|:.:.|. .|..:||.||:::.:.::||||    |...:.|||.|||     
Zfish    24 KIVGGYECTKNGVPYQVSLN-SGYHFCGGSLISNLWVVSAAHC----YKSRVQVRLGEHN----- 78

  Fly   147 VKIVDR-----RVSRVLIHPKYSTRNFDSDIALIRFNEPVRLGIDMHPVCMPTPSENYAGQTAVV 206
            :.:.:.     ...:|:.||.|::...|:|:.||:.:...::...:..|.:|:...: :|.:.::
Zfish    79 IDVTEGTEQFINSEKVIRHPSYNSNTLDNDVMLIKLSSSAQINSYVKTVSLPSSCAS-SGTSCLI 142

  Fly   207 TGWGALS-EGGPISDTLQEVEVPILSQEECRNSNYGESKITDNMICAGYVEQGGKDSCQGDSGGP 270
            :|||.:| .|......|..:..||||...|||:..|:  |:.||.|||::| |||||||||||||
Zfish   143 SGWGNMSASGSNYPSRLMCLNAPILSDSTCRNAYPGQ--ISSNMFCAGFME-GGKDSCQGDSGGP 204

  Fly   271 MHVLGSGDAYQLAGIVSWGEGCAKPNAPGVYTRVGSFNDWIAENTRDA 318
            : |..:    ||.||||||.|||:.|.||||.:|.:|..|| .||.::
Zfish   205 V-VCNN----QLQGIVSWGYGCAQRNKPGVYAKVCNFTTWI-RNTMNS 246

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18735NP_652645.1 Tryp_SPc 82..311 CDD:214473 87/234 (37%)
Tryp_SPc 83..314 CDD:238113 89/236 (38%)
prss1NP_571783.2 Tryp_SPc 24..240 CDD:214473 87/234 (37%)
Tryp_SPc 25..243 CDD:238113 89/237 (38%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100031
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
43.810

Return to query results.
Submit another query.