DRSC - DRSC Integrative Ortholog Prediction Tool

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits

Protein Alignment CG18735 and BMP1

DIOPT Version :9

Sequence 1:	NP_652645.1	Gene:	CG18735 / 59137	FlyBaseID:	FBgn0042098	Length:	364	Species:	Drosophila melanogaster
Sequence 2:	NP_006120.1	Gene:	BMP1 / 649	HGNCID:	1067	Length:	986	Species:	Homo sapiens

Alignment Length:	131	Identity:	31/131 - (23%)
Similarity:	47/131 - (35%)	Gaps:	40/131 - (30%)

- Green bases have known domain annotations that are detailed below.

  Fly    19 CATPSLRSASDPEKILNNLAQLRQSSFLDWIQSILGPEVPAEWSSPAKRECAECSCGNINTRHRI 83
            |:.|: |...: ::.||.|...:.|.            .|....:|.||.| |.:||...|:
Human   551 CSRPN-RGGCE-QRCLNTLGSYKCSC------------DPGYELAPDKRRC-EAACGGFLTK--- 597

  Fly    84 VGGQETE---VHEYP------WMIML-------MWF------GNFYCGASLVNDQYALTAAHCVN 126
            :.|..|.   ..|||      |.::.       :.|      ||..|....|..:..|||...::
Human   598 LNGSITSPGWPKEYPPNKNCIWQLVAPTQYRISLQFDFFETEGNDVCKYDFVEVRSGLTADSKLH 662

  Fly   127 G 127
            |
Human   663 G 663

Known Domains:

Indicated by green bases in alignment.

Gene	Sequence	Domain	Region	External ID	Identity
CG18735	NP_652645.1	Tryp_SPc	82..311	CDD:214473	15/68 (22%)
CG18735	NP_652645.1	Tryp_SPc	83..314	CDD:238113	15/67 (22%)
BMP1	NP_006120.1	ZnMc_BMP1_TLD	121..320	CDD:239808
		Astacin	128..321	CDD:279708
		CUB	322..431	CDD:278839
		CUB	435..544	CDD:278839
		FXa_inhibition	555..587	CDD:291342	9/45 (20%)
		CUB	591..700	CDD:278839	18/76 (24%)
		FXa_inhibition	707..742	CDD:291342
		CUB	747..856	CDD:278839
		CUB	860..973	CDD:278839
Blue background indicates that the domain is not in the aligned region.

Information from Original Tools:

Tool	Simple Score	Weighted Score	Original Tool Information
Tool	Simple Score	Weighted Score	BLAST Result	Score	Score Type	Cluster ID
Compara	0	0.000	Not matched by this tool.
Domainoid	0	0.000	Not matched by this tool.
eggNOG	0	0.000	Not matched by this tool.
Hieranoid	0	0.000	Not matched by this tool.
Homologene	0	0.000	Not matched by this tool.
Inparanoid	0	0.000	Not matched by this tool.
Isobase	0	0.000	Not matched by this tool.
OMA	0	0.000	Not matched by this tool.
OrthoDB	0	0.000	Not matched by this tool.
OrthoFinder	0	0.000	Not matched by this tool.
OrthoInspector	0	0.000	Not matched by this tool.
orthoMCL	0	0.000	Not matched by this tool.
Panther	0	0.000	Not matched by this tool.
Phylome	1	0.910	-	-
RoundUp	0	0.000	Not matched by this tool.
SonicParanoid	0	0.000	Not matched by this tool.
SwiftOrtho	0	0.000	Not matched by this tool.
TreeFam	0	0.000	Not matched by this tool.
User_Submission	0	0.000	Not matched by this tool.
	1	0.910