DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18735 and TMPRSS3

DIOPT Version :9

Sequence 1:NP_652645.1 Gene:CG18735 / 59137 FlyBaseID:FBgn0042098 Length:364 Species:Drosophila melanogaster
Sequence 2:NP_076927.1 Gene:TMPRSS3 / 64699 HGNCID:11877 Length:454 Species:Homo sapiens


Alignment Length:319 Identity:114/319 - (35%)
Similarity:167/319 - (52%) Gaps:32/319 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    16 DLACAT---PSLRSASDPEKILNNLAQLRQSSFLDWIQSILGPEVPAEWSSPAKRE-CA------ 70
            ::|||.   ||..| ||..::.:...|.|: .|:.....:...:|.|...|...|| ||      
Human   139 NVACAQLGFPSYVS-SDNLRVSSLEGQFRE-EFVSIDHLLPDDKVTALHHSVYVREGCASGHVVT 201

  Fly    71 -EC-SCGN-INTRHRIVGGQETEVHEYPWMIMLMWFGNFYCGASLVNDQYALTAAHCVNGFY--- 129
             :| :||: .....|||||..:.:.::||...|.:.|...||.|::...:.:||||||...|   
Human   202 LQCTACGHRRGYSSRIVGGNMSLLSQWPWQASLQFQGYHLCGGSVITPLWIITAAHCVYDLYLPK 266

  Fly   130 ---HRLITVRLLEHNRQDSHVKIVDRRVSRVLIHPKYSTRNFDSDIALIRFNEPVRLGIDMHPVC 191
               .::..|.||: |...||:      |.:::.|.||..:...:||||::...|:.....:.|||
Human   267 SWTIQVGLVSLLD-NPAPSHL------VEKIVYHSKYKPKRLGNDIALMKLAGPLTFNEMIQPVC 324

  Fly   192 MPTPSENYA-GQTAVVTGWGALSEG-GPISDTLQEVEVPILSQEECRNSNYGESKITDNMICAGY 254
            :|...||:. |:....:||||..:| |..|..|....||::|.:.|.:.:.....|:.:|:||||
Human   325 LPNSEENFPDGKVCWTSGWGATEDGAGDASPVLNHAAVPLISNKICNHRDVYGGIISPSMLCAGY 389

  Fly   255 VEQGGKDSCQGDSGGPMHVLGSGDAYQLAGIVSWGEGCAKPNAPGVYTRVGSFNDWIAE 313
            : .||.||||||||||: |......::|.|..|:|.|||:.|.|||||||.||.|||.|
Human   390 L-TGGVDSCQGDSGGPL-VCQERRLWKLVGATSFGIGCAEVNKPGVYTRVTSFLDWIHE 446

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18735NP_652645.1 Tryp_SPc 82..311 CDD:214473 90/236 (38%)
Tryp_SPc 83..314 CDD:238113 92/239 (38%)
TMPRSS3NP_076927.1 LDLa 74..107 CDD:238060
SRCR_2 112..210 CDD:292133 21/72 (29%)
Tryp_SPc 216..444 CDD:214473 90/236 (38%)
Tryp_SPc 217..447 CDD:238113 92/239 (38%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 175 1.000 Inparanoid score I4057
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100031
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.860

Return to query results.
Submit another query.