DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18735 and PRSS56

DIOPT Version :9

Sequence 1:NP_652645.1 Gene:CG18735 / 59137 FlyBaseID:FBgn0042098 Length:364 Species:Drosophila melanogaster
Sequence 2:NP_001356777.1 Gene:PRSS56 / 646960 HGNCID:39433 Length:604 Species:Homo sapiens


Alignment Length:283 Identity:112/283 - (39%)
Similarity:151/283 - (53%) Gaps:16/283 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly    64 PAKRECAE--CSCGNINTRH-RIVGGQETEVHEYPWMIMLMWFGNFYCGASLVNDQYALTAAHCV 125
            |....|.|  .|..|:...| |||||.......:||::.|...|...||..||...:.||||||.
Human    83 PEPGPCGERRPSTANVTRAHGRIVGGSAAPPGAWPWLVRLQLGGQPLCGGVLVAASWVLTAAHCF 147

  Fly   126 NGFYHRLI-TVRLLEHNRQDSHVKIVDRRVSRVLIHPKYSTRNFDSDIALIRFNEPVRLGIDMHP 189
            .|..:.|: ||.|.|.:|.:...::   .|:|:|.|||:..|.|.:|:||::...||..|....|
Human   148 VGAPNELLWTVTLAEGSRGEQAEEV---PVNRILPHPKFDPRTFHNDLALVQLWTPVSPGGSARP 209

  Fly   190 VCMP-TPSENYAGQTAVVTGWGALSEGGPISDTLQEVEVPILSQEECRNSNYGESKITDNMICAG 253
            ||:| .|.|..||....:.|||||.|.||.::.::|..||:||.:.||.: .|.......|:|||
Human   210 VCLPQEPQEPPAGTACAIAGWGALFEDGPEAEAVREARVPLLSTDTCRRA-LGPGLRPSTMLCAG 273

  Fly   254 YVEQGGKDSCQGDSGGPMHVLGSGDAYQ--LAGIVSWGEGCAKPNAPGVYTRVGSFNDWIAENTR 316
            |: .||.||||||||||:.....|...:  |.|:.|||:||.:|..|||||||..|.||:.|...
Human   274 YL-AGGVDSCQGDSGGPLTCSEPGPRPREVLFGVTSWGDGCGEPGKPGVYTRVAVFKDWLQEQMS 337

  Fly   317 DACSCAQPEA----AGEPASPME 335
            .|.|..:|..    |.:|...::
Human   338 AASSSREPSCRELLAWDPPQELQ 360

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18735NP_652645.1 Tryp_SPc 82..311 CDD:214473 99/232 (43%)
Tryp_SPc 83..314 CDD:238113 99/234 (42%)
PRSS56NP_001356777.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 64..96 4/12 (33%)
Tryp_SPc 105..335 CDD:238113 99/234 (42%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 443..475
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 574..604
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0001240
OrthoInspector 1 1.000 - - otm42230
orthoMCL 1 0.900 - - OOG6_100031
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X11
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
54.810

Return to query results.
Submit another query.