DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18735 and Tmprss11d

DIOPT Version :9

Sequence 1:NP_652645.1 Gene:CG18735 / 59137 FlyBaseID:FBgn0042098 Length:364 Species:Drosophila melanogaster
Sequence 2:NP_001028824.2 Gene:Tmprss11d / 64565 RGDID:620654 Length:417 Species:Rattus norvegicus


Alignment Length:249 Identity:90/249 - (36%)
Similarity:135/249 - (54%) Gaps:27/249 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    79 TRHRIVGGQETEVHEYPWMIMLMWFGNFYCGASLVNDQYALTAAHCVNGFYH----------RLI 133
            :..||:||.:.|..::||.:.|......:||.:|:::.:.||||||...:.:          ..|
  Rat   182 SEERIIGGTQAETGDWPWQVSLQLNNVHHCGGTLISNLWVLTAAHCFRSYSNPQQWTATFGVSTI 246

  Fly   134 TVRLLEHNRQDSHVKIVDRRVSRVLIHPKYSTRNFDSDIALIRFNEPVRLGIDMHPVCMPTPSEN 198
            :.||..             ||..:|.|.:|::...|:|||:::.:.||....::|.||:|..::|
  Rat   247 SPRLRV-------------RVRAILAHAEYNSITRDNDIAVVQLDRPVTFTRNIHRVCLPAATQN 298

  Fly   199 -YAGQTAVVTGWGALSEGGPISDTLQEVEVPILSQEECRN-SNYGESKITDNMICAGYVEQGGKD 261
             .....|.|||||:|:.||.....||:.||.|:|.|.|.. :.||.| :...|:||| |..|..|
  Rat   299 IIPDSVAYVTGWGSLTYGGNTVTNLQQGEVRIVSSEVCNEPAGYGGS-VLPGMLCAG-VRSGAVD 361

  Fly   262 SCQGDSGGPMHVLGSGDAYQLAGIVSWGEGCAKPNAPGVYTRVGSFNDWIAENT 315
            :||||||||:....:...:.:.||||||..|..||.|||||||.::.:||.:.|
  Rat   362 ACQGDSGGPLVQEDTRRLWFVVGIVSWGYQCGLPNKPGVYTRVTAYRNWIRQQT 415

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18735NP_652645.1 Tryp_SPc 82..311 CDD:214473 87/240 (36%)
Tryp_SPc 83..314 CDD:238113 88/242 (36%)
Tmprss11dNP_001028824.2 SEA 48..150 CDD:396113
Tryp_SPc 186..414 CDD:238113 88/242 (36%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 178 1.000 Inparanoid score I3918
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X11
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.960

Return to query results.
Submit another query.