DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18735 and TPSB2

DIOPT Version :9

Sequence 1:NP_652645.1 Gene:CG18735 / 59137 FlyBaseID:FBgn0042098 Length:364 Species:Drosophila melanogaster
Sequence 2:NP_077078.5 Gene:TPSB2 / 64499 HGNCID:14120 Length:275 Species:Homo sapiens


Alignment Length:265 Identity:103/265 - (38%)
Similarity:146/265 - (55%) Gaps:28/265 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    65 AKRECAECSCGNINTRHRIVGGQETEVHEYPWMIML-----MWFGNFYCGASLVNDQYALTAAHC 124
            |.|..|..:.|....|..||||||....::||.:.|     .|.  .:||.||::.|:.||||||
Human    13 ASRAYAAPAPGQALQRVGIVGGQEAPRSKWPWQVSLRVRDRYWM--HFCGGSLIHPQWVLTAAHC 75

  Fly   125 VNGFYHRLITVRLLEHNRQDSHVKIVDR--RVSRVLIHPKYSTRNFDSDIALIRFNEPVRLGIDM 187
            |......|..:|:   ..::.|:...|:  .|||:::||::.|....:||||:...|||.:...:
Human    76 VGPDVKDLAALRV---QLREQHLYYQDQLLPVSRIIVHPQFYTAQIGADIALLELEEPVNVSSHV 137

  Fly   188 HPVCMPTPSENY-AGQTAVVTGWGAL--SEGGPISDTLQEVEVPILSQEECRNSNY------GES 243
            |.|.:|..||.: .|....|||||.:  .|..|....|::|:|||:....| ::.|      |:.
Human   138 HTVTLPPASETFPPGMPCWVTGWGDVDNDERLPPPFPLKQVKVPIMENHIC-DAKYHLGAYTGDD 201

  Fly   244 K--ITDNMICAGYVEQGGKDSCQGDSGGPMHVLGSGDAYQLAGIVSWGEGCAKPNAPGVYTRVGS 306
            .  :.|:|:|||...   :||||||||||:....:|...| ||:||||||||:||.||:||||..
Human   202 VRIVRDDMLCAGNTR---RDSCQGDSGGPLVCKVNGTWLQ-AGVVSWGEGCAQPNRPGIYTRVTY 262

  Fly   307 FNDWI 311
            :.|||
Human   263 YLDWI 267

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18735NP_652645.1 Tryp_SPc 82..311 CDD:214473 96/246 (39%)
Tryp_SPc 83..314 CDD:238113 98/247 (40%)
TPSB2NP_077078.5 Tryp_SPc 31..268 CDD:238113 98/247 (40%)
Tryp_SPc 31..267 CDD:214473 96/245 (39%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165152905
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X11
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.840

Return to query results.
Submit another query.