DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18735 and zgc:123295

DIOPT Version :9

Sequence 1:NP_652645.1 Gene:CG18735 / 59137 FlyBaseID:FBgn0042098 Length:364 Species:Drosophila melanogaster
Sequence 2:NP_001032651.1 Gene:zgc:123295 / 641564 ZFINID:ZDB-GENE-051127-11 Length:310 Species:Danio rerio


Alignment Length:248 Identity:107/248 - (43%)
Similarity:147/248 - (59%) Gaps:12/248 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly    74 CGNINTRHRIVGGQETEVHEYPWMIMLM--WFGNFYCGASLVNDQYALTAAHCVNGFYHRL--IT 134
            ||......:|||||......:||.:.|.  .:|..:||.||:|..:.|:||||   |...:  |.
Zfish    27 CGRAPLNTKIVGGQNAGAGSWPWQVSLQSPTYGGHFCGGSLINKDWVLSAAHC---FQDSIGTIM 88

  Fly   135 VRLLEHNRQDSHVKIVDRRVSRVLIHPKYSTRNFDSDIALIRFNEPVRLGIDMHPVCMPTPSENY 199
            |:|...::..|:...:.:.|.:|:.||.|:..:.|:||||::.:..|.....:.|||:......|
Zfish    89 VKLGLQSQSGSNPYQITKTVVQVINHPNYNNPSNDNDIALVKLDSSVTFNDYIEPVCLAAAGNTY 153

  Fly   200 -AGQTAVVTGWGALSE-GGPISDTLQEVEVPILSQEECRNSNYGESKITDNMICAGYVEQGGKDS 262
             ||..:.|||||.||. ...|.|.|||||:||:|..:|:.:..||  ||.||||||.::||||||
Zfish   154 AAGTLSWVTGWGKLSSAANQIPDILQEVEIPIVSHSDCKRAYPGE--ITSNMICAGLLDQGGKDS 216

  Fly   263 CQGDSGGPMHVLGSGDAYQLAGIVSWGEGCAKPNAPGVYTRVGSFNDWIAENT 315
            ||||||||| |..:|..:..:||||:|.|||:|..||||.||..:.|||..:|
Zfish   217 CQGDSGGPM-VSRNGSQWIQSGIVSFGRGCAEPGYPGVYARVSQYQDWITSST 268

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18735NP_652645.1 Tryp_SPc 82..311 CDD:214473 102/234 (44%)
Tryp_SPc 83..314 CDD:238113 104/236 (44%)
zgc:123295NP_001032651.1 Tryp_SPc 35..264 CDD:214473 102/234 (44%)
Tryp_SPc 36..264 CDD:238113 102/233 (44%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170587790
Domainoid 1 1.000 191 1.000 Domainoid score I3175
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 201 1.000 Inparanoid score I3731
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D380103at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - mtm6349
orthoMCL 1 0.900 - - OOG6_100031
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X11
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
98.800

Return to query results.
Submit another query.