DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18735 and zgc:123217

DIOPT Version :9

Sequence 1:NP_652645.1 Gene:CG18735 / 59137 FlyBaseID:FBgn0042098 Length:364 Species:Drosophila melanogaster
Sequence 2:NP_001032480.1 Gene:zgc:123217 / 641414 ZFINID:ZDB-GENE-051113-188 Length:326 Species:Danio rerio


Alignment Length:258 Identity:82/258 - (31%)
Similarity:130/258 - (50%) Gaps:21/258 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly    71 ECSCGNINTRHRIVGGQETEVHEYPWMIMLMWFGNFYCGASLVNDQYALTAAHCVNGFYHRLITV 135
            ||....:||  |||||.:.....:||.:.:.:.....||.:|::.|:.:|||||:   .:..|.|
Zfish    27 ECGVAPLNT--RIVGGTDAPAGSWPWQVSIHYNNRHICGGTLIHSQWVMTAAHCI---INTNINV 86

  Fly   136 RLLEHNRQDSHVKIVDRR-----VSRVLIHPKYSTRNFDSDIALIRFNEPVRLGIDMHPVCM-PT 194
            ..|...||.....:.:..     :..::.||.::....::||:|::.::||...:.:.|:|: ..
Zfish    87 WTLYLGRQTQSTSVANPNEVKVGIQSIIDHPSFNNSLLNNDISLMKLSQPVNFSLYIRPICLAAN 151

  Fly   195 PSENYAGQTAVVTGWGAL--SEGGPISDTLQEVEVPILSQEECRN--SNYGESKITDNMICAGYV 255
            .|..|.|.:...||||.:  .:..|...|||:|::|:::...|..  .:...:.||..|||||  
Zfish   152 NSIFYNGTSCWATGWGNIGKDQALPAPQTLQQVQIPVVANSLCSTEYESVNNATITPQMICAG-- 214

  Fly   256 EQGGKDSCQGDSGGPMHVLGSGDAYQLAGIVSWG--EGCAKPNAPGVYTRVGSFNDWIAENTR 316
             :..|.:||||||||.. ...|..:..|||.|:|  .|||....|.||:||..|..||..|.:
Zfish   215 -KANKGTCQGDSGGPFQ-CKQGSVWIQAGITSYGTSAGCAVGAYPDVYSRVSEFQSWIKMNVQ 275

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18735NP_652645.1 Tryp_SPc 82..311 CDD:214473 75/240 (31%)
Tryp_SPc 83..314 CDD:238113 76/242 (31%)
zgc:123217NP_001032480.1 Tryp_SPc 36..270 CDD:214473 75/240 (31%)
Tryp_SPc 37..273 CDD:238113 76/242 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 191 1.000 Domainoid score I3175
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - mtm6349
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X11
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
43.910

Return to query results.
Submit another query.