DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18735 and PRSS22

DIOPT Version :9

Sequence 1:NP_652645.1 Gene:CG18735 / 59137 FlyBaseID:FBgn0042098 Length:364 Species:Drosophila melanogaster
Sequence 2:NP_071402.1 Gene:PRSS22 / 64063 HGNCID:14368 Length:317 Species:Homo sapiens


Alignment Length:290 Identity:95/290 - (32%)
Similarity:157/290 - (54%) Gaps:26/290 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly    73 SCGNINTRHRIVGGQETEVHEYPWMIMLMWFGNFYCGASLVNDQYALTAAHC----VNGFYHRLI 133
            :||.....:|:|||:::...|:||::.:...|..:|..||:..::.:|||||    :|..|...:
Human    40 ACGKPQQLNRVVGGEDSTDSEWPWIVSIQKNGTHHCAGSLLTSRWVITAAHCFKDNLNKPYLFSV 104

  Fly   134 TVRLLEHNRQDSHVKIVDRRVSRVLIHPKYSTR-NFDSDIALIRFNEPVRLGIDMHPVCMPTPSE 197
            .:...:.....|..:.|.  |:.|..||.||.: ...:||||:|....::....:.|:|:|..|.
Human   105 LLGAWQLGNPGSRSQKVG--VAWVEPHPVYSWKEGACADIALVRLERSIQFSERVLPICLPDASI 167

  Fly   198 NYAGQT-AVVTGWGALSEGGPI--SDTLQEVEVPILSQEECRNSNY---GESKITDNMICAGYVE 256
            :....| ..::|||::.:|.|:  ..|||:::|||:..|.|.:..:   |:..||::|:||||:|
Human   168 HLPPNTHCWISGWGSIQDGVPLPHPQTLQKLKVPIIDSEVCSHLYWRGAGQGPITEDMLCAGYLE 232

  Fly   257 QGGKDSCQGDSGGPMHVLGSGDAYQLAGIVSWGEGCAKPNAPGVYTRVGSFNDWIAENTRDACSC 321
             |.:|:|.||||||:.....| |:.||||:|||||||:.|.||||..:.:...|:.:..:.....
Human   233 -GERDACLGDSGGPLMCQVDG-AWLLAGIISWGEGCAERNRPGVYISLSAHRSWVEKIVQGVQLR 295

  Fly   322 AQPEAAGEPASPMETTEQGDQENTTANGAA 351
            .:.:..|...:|    .||       :|||
Human   296 GRAQGGGALRAP----SQG-------SGAA 314

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18735NP_652645.1 Tryp_SPc 82..311 CDD:214473 85/239 (36%)
Tryp_SPc 83..314 CDD:238113 85/241 (35%)
PRSS22NP_071402.1 Tryp_SPc 50..288 CDD:238113 85/241 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D380103at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X11
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.920

Return to query results.
Submit another query.