DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18735 and CELA2A

DIOPT Version :9

Sequence 1:NP_652645.1 Gene:CG18735 / 59137 FlyBaseID:FBgn0042098 Length:364 Species:Drosophila melanogaster
Sequence 2:NP_254275.1 Gene:CELA2A / 63036 HGNCID:24609 Length:269 Species:Homo sapiens


Alignment Length:242 Identity:83/242 - (34%)
Similarity:127/242 - (52%) Gaps:19/242 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly    82 RIVGGQETEVHEYPWMIMLMWF--GNFY--CGASLVNDQYALTAAHCVNGFYHRLITVRLLEHNR 142
            |:|||:|...:.:||.:.|.:.  |.:|  ||.||:.:.:.||||||::.  .|...|.|..||.
Human    28 RVVGGEEARPNSWPWQVSLQYSSNGKWYHTCGGSLIANSWVLTAAHCISS--SRTYRVGLGRHNL 90

  Fly   143 QDSHVKIVDRRVSRVLIHPKYSTRNFD--SDIALIRFNEPVRLGIDMHPVCMPTPS----ENYAG 201
            ..:....:...||::::|..:::....  :||||::...||.|...:...|:|...    .||  
Human    91 YVAESGSLAVSVSKIVVHKDWNSNQISKGNDIALLKLANPVSLTDKIQLACLPPAGTILPNNY-- 153

  Fly   202 QTAVVTGWGALSEGGPISDTLQEVEVPILSQEECRNSNYGESKITDNMICAGYVEQGGKDSCQGD 266
             ...|||||.|...|.:.|.||:..:.::....|.:|.:..|.:..:|||||  ..|...||.||
Human   154 -PCYVTGWGRLQTNGAVPDVLQQGRLLVVDYATCSSSAWWGSSVKTSMICAG--GDGVISSCNGD 215

  Fly   267 SGGPMHVLGSGDAYQLAGIVSWGE--GCAKPNAPGVYTRVGSFNDWI 311
            ||||::...|...:|:.||||:|.  ||...:.|.|:|||.::.|||
Human   216 SGGPLNCQASDGRWQVHGIVSFGSRLGCNYYHKPSVFTRVSNYIDWI 262

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18735NP_652645.1 Tryp_SPc 82..311 CDD:214473 81/240 (34%)
Tryp_SPc 83..314 CDD:238113 82/241 (34%)
CELA2ANP_254275.1 Tryp_SPc 29..265 CDD:238113 82/241 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X11
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.