DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18735 and c1s

DIOPT Version :9

Sequence 1:NP_652645.1 Gene:CG18735 / 59137 FlyBaseID:FBgn0042098 Length:364 Species:Drosophila melanogaster
Sequence 2:XP_002941253.2 Gene:c1s / 613055 XenbaseID:XB-GENE-995410 Length:691 Species:Xenopus tropicalis


Alignment Length:290 Identity:93/290 - (32%)
Similarity:143/290 - (49%) Gaps:42/290 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    43 SSFLDWIQSILGPEVPAEWSSPAKRECAECSCGNINTRHRIVGGQETEVHEYPWMIML--MWFGN 105
            ||:..|:.|....|:|.  .:|.      |.....:...||.||...:..::||||..  :..| 
 Frog   405 SSYGYWVNSRGNKELPI--CTPV------CGVHQSDKSGRIFGGTRAKPGQFPWMIQFTDIELG- 460

  Fly   106 FYCGASLVNDQYALTAAHCVNGFYHRLI---TVRLLEHNRQDSHVKIVDRRVSRVLIHPKYSTR- 166
               |.||::|::.|||||.||......:   .::...:....|..|.:  :..:::|||.|... 
 Frog   461 ---GGSLISDRWVLTAAHVVNKKIFPTMFGGVMKFFPNTNLQSQEKRL--QAKKIIIHPLYQDNE 520

  Fly   167 ------NFDSDIALIRFNEPVRLGIDMHPVCMP----TPSENYAGQTAVVTGWGALSEGGPISDT 221
                  |||:||||::..:.|:||..:.|:|:|    .|..|   :.|.:.|||. :|....:..
 Frog   521 DTEGQSNFDNDIALVQLTKKVKLGSCISPICLPRRGLAPVVN---EVATIAGWGK-TEKRESAVN 581

  Fly   222 LQEVEVPILSQEECRNSNYGESKITDNMICAGYVEQGGKDSCQGDSGGPMHVLGSGDAYQ--LAG 284
            ||...:.:.|.::|:.:..|:...|.||:|||  ...|||||.||||||:......|:.:  :||
 Frog   582 LQFASISLSSMDKCKKATGGKGYFTPNMLCAG--SDVGKDSCNGDSGGPLMFTDPQDSSKMYMAG 644

  Fly   285 IVSWG-EGCAKPNAPGVYTRVGSFNDWIAE 313
            ||||| ..|   ...|:||:|.::.|||.|
 Frog   645 IVSWGPRDC---GTYGLYTKVDNYLDWIEE 671

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18735NP_652645.1 Tryp_SPc 82..311 CDD:214473 82/247 (33%)
Tryp_SPc 83..314 CDD:238113 84/250 (34%)
c1sXP_002941253.2 CUB 21..131 CDD:238001
FXa_inhibition 145..173 CDD:405372
CUB 177..288 CDD:238001
PHA02927 301..>436 CDD:222943 8/38 (21%)
Tryp_SPc 436..669 CDD:214473 82/247 (33%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.