DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18735 and LOC595077

DIOPT Version :9

Sequence 1:NP_652645.1 Gene:CG18735 / 59137 FlyBaseID:FBgn0042098 Length:364 Species:Drosophila melanogaster
Sequence 2:XP_031748571.1 Gene:LOC595077 / 595077 -ID:- Length:752 Species:Xenopus tropicalis


Alignment Length:309 Identity:107/309 - (34%)
Similarity:150/309 - (48%) Gaps:39/309 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    73 SCGNINTRHRIVGGQETEVHEYPWMIMLMWFGNFYCGASLVNDQYALTAAHCVNGFYHRLITVRL 137
            :||......|||||..::..|:||.|.|.:...|.||.||:.|.:.:.||||.:.......||.|
 Frog    25 ACGVPVVSDRIVGGMNSKKGEWPWQISLNYKNEFICGGSLITDSWVMAAAHCFDSLKVSYYTVYL 89

  Fly   138 LEHNRQDSHVKIVDRRVSRVLIHPKYSTRNFDSDIALIRFNEPVRLGIDMHPVCMPTPS-ENYAG 201
            ..:.........|.|.|.:::.:|.:.......||||:....||.....:.|||:|:.. :..||
 Frog    90 GAYQLSALDNSTVSRGVKKIIKNPNFLYEGSSGDIALMELETPVTFTPYILPVCLPSQEVQLAAG 154

  Fly   202 QTAVVTGWGALSEGGPISD--TLQEVEVPILSQEECRN---SNYGESK----ITDNMICAGYVEQ 257
            ....|||||...||.|:|:  |||..||.|:|...|.:   |::|.|.    |.::|:|||| ::
 Frog   155 TMCWVTGWGDTQEGIPLSNPKTLQMAEVGIISSSSCEDMYESSFGYSTGGTFIQEDMVCAGY-QE 218

  Fly   258 GGKDSCQGDSGGPMHVLGSGDAYQLAGIVSWGEGCAKPNAPGVYTRVGSFNDWIAENTRDACSCA 322
            |..|:||||||||: |....:.:...||||||.|||:||.|||||:|..:.||:....       
 Frog   219 GQIDACQGDSGGPL-VCNVNNVWLQFGIVSWGYGCAEPNKPGVYTKVQYYQDWLKTKV------- 275

  Fly   323 QPEAAGEPASPMETTEQGDQEN------TTANGAAEA----DPEVEEAN 361
                      |..|..:|...|      ||.....||    ..|:::.|
 Frog   276 ----------PFLTFSEGGPSNGSSSVATTTMSQTEAQSLNSTEIDKTN 314

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18735NP_652645.1 Tryp_SPc 82..311 CDD:214473 94/238 (39%)
Tryp_SPc 83..314 CDD:238113 94/240 (39%)
LOC595077XP_031748571.1 Tryp_SPc 35..272 CDD:238113 94/238 (39%)
Tryp_SPc 431..670 CDD:238113
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 183 1.000 Inparanoid score I3837
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D380103at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X11
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
44.060

Return to query results.
Submit another query.