DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18735 and CG34458

DIOPT Version :9

Sequence 1:NP_652645.1 Gene:CG18735 / 59137 FlyBaseID:FBgn0042098 Length:364 Species:Drosophila melanogaster
Sequence 2:NP_001097340.1 Gene:CG34458 / 5740868 FlyBaseID:FBgn0085487 Length:257 Species:Drosophila melanogaster


Alignment Length:246 Identity:78/246 - (31%)
Similarity:129/246 - (52%) Gaps:35/246 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    82 RIVGGQETEVHEYPWMIMLMWFGNFYCGASLVNDQYALTAAHCVNGFYHRLITVRLLEHNRQDSH 146
            ||:|||.....::|..:.|...|..:||.||::|...:|||||..|              :....
  Fly    31 RIIGGQFAAPGQFPHQVSLQLNGRHHCGGSLISDTMIVTAAHCTMG--------------QNPGQ 81

  Fly   147 VKIV------------DRRVSRVLIHPKYSTRNFDSDIALIRFNEPVRLGIDMHPVCMPTPSENY 199
            :|.:            ...:::.:|||:|:.::.|.|::||:.:.||.:|..:..:.:.....||
  Fly    82 MKAIVGTNDLSAGNGQTFNIAQFIIHPRYNPQSQDFDMSLIKLSSPVPMGGAVQTIQLADSDSNY 146

  Fly   200 AGQT-AVVTGWGALSEGGPISDTLQEVEVPILSQEECRNSNYGESKITDNMICAGYVEQGGKDSC 263
            |..| |:::|:||:::...:.:.|:..:|.:.|::.|.:.|.  ..:||.|:|||: ..|...||
  Fly   147 AADTMAMISGFGAINQNLQLPNRLKFAQVQLWSRDYCNSQNI--PGLTDRMVCAGH-PSGQVSSC 208

  Fly   264 QGDSGGPMHVLGSGDAYQLAGIVSWGEGCAKPNAPGVYTRVGSFNDWIAEN 314
            |||||||:.|.|     :|.|:||||.||.....|.:||.||:...||.:|
  Fly   209 QGDSGGPLTVDG-----KLFGVVSWGFGCGAKGRPAMYTYVGALRSWIKQN 254

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18735NP_652645.1 Tryp_SPc 82..311 CDD:214473 75/241 (31%)
Tryp_SPc 83..314 CDD:238113 76/243 (31%)
CG34458NP_001097340.1 Tryp_SPc 31..251 CDD:214473 75/241 (31%)
Tryp_SPc 32..254 CDD:238113 76/243 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0001240
OrthoInspector 1 1.000 - - otm25354
orthoMCL 1 0.900 - - OOG6_100031
Panther 1 1.100 - - P PTHR24256
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
54.910

Return to query results.
Submit another query.