DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18735 and bmp1a

DIOPT Version :9

Sequence 1:NP_652645.1 Gene:CG18735 / 59137 FlyBaseID:FBgn0042098 Length:364 Species:Drosophila melanogaster
Sequence 2:NP_001035126.1 Gene:bmp1a / 572452 ZFINID:ZDB-GENE-060818-1 Length:986 Species:Danio rerio


Alignment Length:238 Identity:50/238 - (21%)
Similarity:72/238 - (30%) Gaps:84/238 - (35%)


- Green bases have known domain annotations that are detailed below.


  Fly    71 ECSCGNINTRHRIVGGQETEVHEYPWMIMLMWFGNFYCGASLVNDQYALTAAHCVNGFYHRLITV 135
            |||..|...:|..|.                .||::.|              .|.:||       
Zfish   705 ECSKENGGCQHECVN----------------TFGSYSC--------------QCRSGF------- 732

  Fly   136 RLLEHNRQD------SHVKIVDRRVSRVLIHPKYSTRNFDSDIAL-------------IRFNEPV 181
             :|..|:.|      .||.   ..||..:..|.:..: :.|..|.             |.|||  
Zfish   733 -VLHENKHDCKEAGCDHVV---NSVSGTITSPNWPDK-YPSKKACTWALSTTPGHRIKIAFNE-- 790

  Fly   182 RLGIDMHP--VCMPTPSENYAGQTAVVTGWG---ALSEGGPISDTLQEVEVPILSQEECRNSNYG 241
               |||.|  .|.....|.|.|:.:.....|   ...:..||..|..::.:...|....:...:.
Zfish   791 ---IDMEPHLECAYDHIEIYDGRDSKAQSLGRYCGTKKPQPIISTGNKMFIRFFSDNSVQKKGFE 852

  Fly   242 ESKITDNMICAGYV--EQGGKDSCQ----GDSGGPMHVLGSGD 278
            .|...:   |.|.:  |...||...    ||:..|    |:.|
Zfish   853 ASHTAE---CGGRLKAEVKTKDLYSHAQFGDNNYP----GASD 888

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18735NP_652645.1 Tryp_SPc 82..311 CDD:214473 45/227 (20%)
Tryp_SPc 83..314 CDD:238113 45/226 (20%)
bmp1aNP_001035126.1 ZnMc_BMP1_TLD 112..309 CDD:239808
Astacin 117..309 CDD:279708
CUB 311..420 CDD:278839
CUB 424..533 CDD:278839
FXa_inhibition 544..576 CDD:291342
CUB 580..699 CDD:278839
FXa_inhibition 706..741 CDD:291342 13/72 (18%)
CUB 746..855 CDD:278839 24/117 (21%)
CUB 859..972 CDD:278839 10/34 (29%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.