DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18735 and si:dkey-21e2.15

DIOPT Version :9

Sequence 1:NP_652645.1 Gene:CG18735 / 59137 FlyBaseID:FBgn0042098 Length:364 Species:Drosophila melanogaster
Sequence 2:XP_003201076.1 Gene:si:dkey-21e2.15 / 567711 ZFINID:ZDB-GENE-050208-780 Length:251 Species:Danio rerio


Alignment Length:246 Identity:80/246 - (32%)
Similarity:121/246 - (49%) Gaps:36/246 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    83 IVGGQETEVHEYPWMIMLMWFGNFYCGASLVNDQYALTAAHC-VNGFYHRLITV-----RLLEHN 141
            |..|.|.:.|..|:|:.|.......||.||:.:::.|||||| ..|   .:|||     .|.|:.
Zfish    26 IEDGTEAKPHSRPYMVSLQKNSKNSCGGSLITEEFVLTAAHCWKKG---DVITVVVGAHDLSENE 87

  Fly   142 RQDSHVKIVDRRVSRVLIHPKYSTRNFDSDIALIRFNEPVRLGIDMHPVCMPTPSENYAGQTAV- 205
            ..||.      .|:..:.||::|.:|:::||.|::.|:.|.|..::..:.:|...|: ..:.|| 
Zfish    88 TYDSF------EVTSYIPHPEFSWQNYENDIMLLKLNKKVTLSNNVGLISLPKNGED-VKEDAVC 145

  Fly   206 -VTGWGALSEGGPISDTLQEVEVPILSQEECR---NSNYGESKITDNMICAGYVEQGGKDSCQGD 266
             |.|||.|...||..|.|.|.|..|:|.|||:   .|.:..||    |.|.    .|...:|:||
Zfish   146 SVAGWGRLWLNGPRPDRLMEAETVIVSGEECKRRWESLFKPSK----MFCV----YGHGGTCKGD 202

  Fly   267 SGGPMHVLGSGDAYQLAGIVSWGE--GCAKPNAPGVYTRVGSFNDWIAENT 315
            ||||: |.|.    ...|:.|:.:  .|.....|.:||::.::..||.:.|
Zfish   203 SGGPL-VCGE----HAVGVTSFSDRYSCNSRLLPNMYTKISAYLSWIQKIT 248

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18735NP_652645.1 Tryp_SPc 82..311 CDD:214473 77/240 (32%)
Tryp_SPc 83..314 CDD:238113 79/243 (33%)
si:dkey-21e2.15XP_003201076.1 Tryp_SPc 26..247 CDD:238113 79/243 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.