DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18735 and AgaP_AGAP011913

DIOPT Version :9

Sequence 1:NP_652645.1 Gene:CG18735 / 59137 FlyBaseID:FBgn0042098 Length:364 Species:Drosophila melanogaster
Sequence 2:XP_001689277.1 Gene:AgaP_AGAP011913 / 5667996 VectorBaseID:AGAP011913 Length:399 Species:Anopheles gambiae


Alignment Length:350 Identity:91/350 - (26%)
Similarity:144/350 - (41%) Gaps:80/350 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 CNFHLLLILATALGD-------LACATPSLRSASDPEKILNNLAQLRQSSFLDWIQSILGPEVPA 59
            |.:..|.|  :..||       :.|.|.:....|...|:               :.::||    :
Mosquito    87 CYYDKLAI--SRFGDPNLSDAIVRCGTTTFNVESQYNKL---------------VVALLG----S 130

  Fly    60 EWSSPAKREC------AECSCGNINTRHR---IVGGQETEVHEYPWMIMLM--WFGNFYCGASLV 113
            ..:|..:..|      ..|.||    ||:   ||.|..|..:|||.|..|:  .....:||:::|
Mosquito   131 TSTSGGRFRCQITALKLACDCG----RHKTPTIVNGFPTLTNEYPMMAGLVDNSLAKVFCGSTIV 191

  Fly   114 NDQYALTAAHCVNGFYHRLITVRLLEHNRQDSHVKIVDR--------------RVSRVLIHPKYS 164
            .|::.||||||            ||:.....:.|.:.|:              |:|....||.|:
Mosquito   192 TDRHVLTAAHC------------LLDRTVTGTSVLVGDQDISTGSDTPYSSLYRISTFTQHPSYN 244

  Fly   165 TRNFDSDIALIRFNEPVRLGIDMHPVCMP--TPSENYAGQTAVVTGWGALSEGGPISDTLQEVEV 227
            ..:..:||||::....:.....:..||:|  ..:.::........||||:..|.|.|:.|.:..:
Mosquito   245 PTSKTNDIALVQTFNTIVFNPGVGRVCLPFFFSTSSFENVRLSALGWGAIDFGAPSSNELLQTTL 309

  Fly   228 PILSQEECRNSNYGESKITDNMICAGYVEQGGKDSCQGDSGGPMHVL--GSGDAYQLAGIVSWGE 290
            .::|...|  .......|..:.:|   ....|.|:||.|||||::..  .|...|.: |:|.:|.
Mosquito   310 TVVSSTSC--GTQLSRTILASQMC---TFAAGNDTCQNDSGGPLYYTDPNSQLVYSI-GVVGFGV 368

  Fly   291 GCAKPNAPGVYTRVGSFNDWIAENT 315
            .||. :.|.|.|||.|:.|||:..|
Mosquito   369 ACAS-SFPSVNTRVTSYLDWISSTT 392

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18735NP_652645.1 Tryp_SPc 82..311 CDD:214473 70/251 (28%)
Tryp_SPc 83..314 CDD:238113 72/250 (29%)
AgaP_AGAP011913XP_001689277.1 CUB 35..144 CDD:238001 13/77 (17%)
Tryp_SPc 159..391 CDD:238113 72/250 (29%)
Tryp_SPc 159..388 CDD:214473 70/247 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X11
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.