DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18735 and AgaP_AGAP011918

DIOPT Version :9

Sequence 1:NP_652645.1 Gene:CG18735 / 59137 FlyBaseID:FBgn0042098 Length:364 Species:Drosophila melanogaster
Sequence 2:XP_001689276.1 Gene:AgaP_AGAP011918 / 5667954 VectorBaseID:AGAP011918 Length:259 Species:Anopheles gambiae


Alignment Length:273 Identity:83/273 - (30%)
Similarity:122/273 - (44%) Gaps:56/273 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    70 AECSCG------NINTRHRIVGGQETEVHEYPWMIML--MWFGNFYCGASLVNDQYALTAAHCVN 126
            |..:||      ..:...|||.|......::|:.:.|  ..:.:| ||.:::.:.:.||||||:.
Mosquito    13 ASVACGEDAALRTADWEGRIVNGLNAVSGQFPYQVSLTSATYQHF-CGGAIIGNHWILTAAHCLT 76

  Fly   127 GFYHRLITVRLLEHNRQDSHVKIV-----------DRRVSRVLIHPKYSTRNFDSDIALIRFNEP 180
            |              |:.:.|..|           :..|.:.::||.::.....:||||:|....
Mosquito    77 G--------------RKPAEVIAVVGALTSARGGYNYDVEQFILHPNFNEWTQQNDIALVRTKWS 127

  Fly   181 VRLGIDMHPVCMP---TPSENYAGQTAVVTGWG--ALSEGGPISDTLQEVEVPILSQEEC--RNS 238
            :.....:.||.|.   ||    |.:..:.:|||  .||...| :|.||.|.:..:|.|:|  |..
Mosquito   128 ISFNTAVFPVKMARTYTP----ANRAVLASGWGLTTLSVPKP-ADRLQYVALRTISNEDCSERFR 187

  Fly   239 NYGESKITDNMICA-GYVEQGGKDSCQGDSGGPMHVLGSGDAYQLAGIVSWGEGCAKPNAPGVYT 302
            ......||.:::|. ...|||   :|.||||||:...|     :|.||||||..|| ...|.||.
Mosquito   188 KLQNRAITPSILCTFSRNEQG---TCMGDSGGPLVEDG-----ELVGIVSWGIPCA-VGYPDVYV 243

  Fly   303 RVGSFNDWIAENT 315
            ||.||..||...|
Mosquito   244 RVSSFRAWIGAVT 256

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18735NP_652645.1 Tryp_SPc 82..311 CDD:214473 77/249 (31%)
Tryp_SPc 83..314 CDD:238113 78/251 (31%)
AgaP_AGAP011918XP_001689276.1 Tryp_SPc 31..252 CDD:214473 77/249 (31%)
Tryp_SPc 32..252 CDD:238113 76/248 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.