DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18735 and AgaP_AGAP001249

DIOPT Version :9

Sequence 1:NP_652645.1 Gene:CG18735 / 59137 FlyBaseID:FBgn0042098 Length:364 Species:Drosophila melanogaster
Sequence 2:XP_001689375.2 Gene:AgaP_AGAP001249 / 5667667 VectorBaseID:AGAP001249 Length:267 Species:Anopheles gambiae


Alignment Length:239 Identity:82/239 - (34%)
Similarity:132/239 - (55%) Gaps:19/239 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly    82 RIVGGQETEVHEYPWMIMLMWFGNFYCGASLVNDQYALTAAHCVNGFYHRL-ITVRLLEHNRQDS 145
            |||||....:.::|:.:.|...||..||||:::..:||:||||........ |:.|....:|...
Mosquito    41 RIVGGSTVPISQFPYQLSLRQNGNHICGASVISSNWALSAAHCTFPMPSAASISFRGGSDSRTGG 105

  Fly   146 HVKIVDRRVSRVLIHPKYSTRNFDSDIALIRFNEPVRLGIDMHPVCMPTPSENY-AGQTAVVTGW 209
            .|..   :.::::.||:|::.|.::|:.:||..... :|.::.|:.:.....:: ||..:||:||
Mosquito   106 GVIF---QAAQIINHPQYNSNNLNNDVCVIRITTSF-VGANIAPIRLVASGTSFAAGTNSVVSGW 166

  Fly   210 GALSEGGPISDTLQEVEVPILSQEECRNSNYGESKITDNMICAGYVEQGGKDSCQGDSGGPMHVL 274
            |..|.||.:...|..|.:|:::|..| :|.:|..:||..|:|||.   .|:|||.||||||: |.
Mosquito   167 GLTSPGGSLPVNLHAVNIPVVAQATC-SSQWGTGRITAAMVCAGV---QGRDSCNGDSGGPL-VT 226

  Fly   275 GSGDAYQLAGIVSWGE-GCAKPNAPGVYTRVGS--FNDWIAENT 315
            |...    .|:||||. .|..| .||||..:|:  ...:|::||
Mosquito   227 GGAQ----FGVVSWGAVQCGGP-LPGVYANIGNAGIRSFISQNT 265

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18735NP_652645.1 Tryp_SPc 82..311 CDD:214473 79/233 (34%)
Tryp_SPc 83..314 CDD:238113 79/235 (34%)
AgaP_AGAP001249XP_001689375.2 Tryp_SPc 41..254 CDD:214473 78/226 (35%)
Tryp_SPc 42..264 CDD:238113 79/235 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.