DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18735 and AgaP_AGAP001251

DIOPT Version :9

Sequence 1:NP_652645.1 Gene:CG18735 / 59137 FlyBaseID:FBgn0042098 Length:364 Species:Drosophila melanogaster
Sequence 2:XP_001689373.2 Gene:AgaP_AGAP001251 / 5667665 VectorBaseID:AGAP001251 Length:290 Species:Anopheles gambiae


Alignment Length:311 Identity:89/311 - (28%)
Similarity:137/311 - (44%) Gaps:56/311 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 LLILATALGDLACATPSLRS---ASDPE--KILNNLAQLRQSSFLDWIQSILGPEVPAEWSSPAK 66
            ||:||..:|.:.|.|.....   :..|:  ::|.......::..|.:.:......||:.:     
Mosquito     4 LLLLAALVGGVLCMTVDYNKYYYSRQPDLFRLLRKYHLWPRNETLKFERPRQDLNVPSPF----- 63

  Fly    67 RECAECSCGNINTRHRIVGGQETEVHEYPWMIMLMWFGNFYCGASLVNDQYALTAAHCVN-GFYH 130
                            |.||:...:..||:.:.|...|...||||::.:::||:||||:: ..|.
Mosquito    64 ----------------IFGGESVAIESYPYQLSLRLEGTHICGASVIAERWALSAAHCLDEALYP 112

  Fly   131 RLITVR-LLEHNRQDSHVKIVDRRVSRVLIHPKYSTRNFDSDIALIR-----FNEPVR-LGIDMH 188
            ..||.| ...|.....::    ......|:|||:..|..|.|:::..     |.:|:| :.:...
Mosquito   113 SAITFRGGTPHRLAGGYI----FHAEYYLLHPKFDRRTLDYDVSVTHVRESFFIDPIRAVTLANT 173

  Fly   189 PVCMPTPSENYAGQTAVVTGWGALSEGGPISDTLQEVEVPILSQEECRNSNYGESKITDNMICAG 253
            ....|.||      .|||||||.....|.....||.:|:.:..::.|..|..  ..:||..||.|
Mosquito   174 NTYYPIPS------AAVVTGWGLADADGYEPLILQSLEIYLQQKQFCWTSTI--EALTDRQICGG 230

  Fly   254 YVEQG--GKDSCQGDSGGPMHVLGSGDAYQLAGIVSWGEGCAKPNAPGVYT 302
               .|  ||::|.||||||:.:.|    ||: ||||||......|.||:||
Mosquito   231 ---SGVYGKETCYGDSGGPLVMNG----YQV-GIVSWGSDNCAVNIPGIYT 273

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18735NP_652645.1 Tryp_SPc 82..311 CDD:214473 77/231 (33%)
Tryp_SPc 83..314 CDD:238113 77/230 (33%)
AgaP_AGAP001251XP_001689373.2 Tryp_SPc 64..277 CDD:214473 77/230 (33%)
Tryp_SPc 64..277 CDD:238113 77/230 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.