DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18735 and AgaP_AGAP005688

DIOPT Version :9

Sequence 1:NP_652645.1 Gene:CG18735 / 59137 FlyBaseID:FBgn0042098 Length:364 Species:Drosophila melanogaster
Sequence 2:XP_001688707.1 Gene:AgaP_AGAP005688 / 5667341 VectorBaseID:AGAP005688 Length:301 Species:Anopheles gambiae


Alignment Length:247 Identity:73/247 - (29%)
Similarity:125/247 - (50%) Gaps:19/247 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly    82 RIVGGQETEVHEYPWMIMLMW---FGNFYCGASLVNDQYALTAAHCVNGFYHRLIT--VRLL-EH 140
            ||..|||....::|:.|:|:.   .|...||.|::...:.|||||||....:.:::  :.:: .|
Mosquito    55 RITNGQEATPGQFPYQIILLSDFPTGTALCGGSVLTRNFILTAAHCVVSGTNTVVSGGIAIMGAH 119

  Fly   141 NR--QDSHVKIVDRRVSRVLIHPKYSTRNFDSDIALIRFNEPVRLGIDMHPVCMPTPSE--NYAG 201
            ||  |::..:.:....|.:..||.|.:.....|||::..|..:.....:.||.:|..|:  .:.|
Mosquito   120 NRTIQEASQQRIRYTASGIRYHPLYVSSTLRYDIAVVLLNSSITFTDRIQPVRLPAQSDTRQFGG 184

  Fly   202 QTAVVTGWGALSEGG-PISDTLQEVEVPILSQEECRNSNYGESKITDNMICAGYVEQGGKDSCQG 265
            ....::|:|..::.. .||..::....|:::...| .:.:|.|.|.|..:|..  ..||:.||.|
Mosquito   185 FVGTLSGFGRTTDASQSISTVVRFTSNPVMTNANC-ITRWGSSNIQDQNVCLS--GTGGRSSCNG 246

  Fly   266 DSGGPMHVLGSGDAYQLAGIVSWG--EGCAKPNAPGVYTRVGSFNDWIAENT 315
            |||||:.| .||...|: |:||:.  .|| :...|.||:||..:.:|:..|:
Mosquito   247 DSGGPLTV-ESGGPIQI-GVVSFVSIRGC-EAGMPSVYSRVSFYLNWVEINS 295

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18735NP_652645.1 Tryp_SPc 82..311 CDD:214473 71/241 (29%)
Tryp_SPc 83..314 CDD:238113 71/243 (29%)
AgaP_AGAP005688XP_001688707.1 Tryp_SPc 55..291 CDD:214473 71/241 (29%)
Tryp_SPc 56..292 CDD:238113 71/241 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.