DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18735 and AgaP_AGAP005702

DIOPT Version :9

Sequence 1:NP_652645.1 Gene:CG18735 / 59137 FlyBaseID:FBgn0042098 Length:364 Species:Drosophila melanogaster
Sequence 2:XP_001688712.1 Gene:AgaP_AGAP005702 / 5667316 VectorBaseID:AGAP005702 Length:269 Species:Anopheles gambiae


Alignment Length:260 Identity:78/260 - (30%)
Similarity:121/260 - (46%) Gaps:48/260 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    82 RIVGGQETEVHEYPWMI-MLMWF--GNFYCGASLVNDQYALTAAHCVNGFYHRLITVRLLEHNRQ 143
            ||..|.|....:.||.. :|:.|  ..::||.:|::.::.||:|:||||:  |.|||.|..|:..
Mosquito    32 RINNGIEAGPTDVPWAAGVLVTFPSNTYFCGGTLISQRHILTSANCVNGY--RTITVMLGAHDMT 94

  Fly   144 DSHVKIVDRRVSRVLIHPKYSTRNFDSDIALIRFNEPVRLGIDMHPVCMPTPSENYAGQT----- 203
            .....|.   |:.||:||.:|:..|.:|:|::..:.|..|...:..|.:  ||..|.|.:     
Mosquito    95 AVQEFIT---VASVLVHPDFSSFFFSNDLAILTLSRPAPLSDRIRVVQL--PSRLYIGHSFNNYE 154

  Fly   204 AVVTGWGALSEGGPISDTLQEVEVPILSQEECRNSNYGESKITDNMIC-------------AGYV 255
            ..:.|||...:      :..|| ||:      |...|..:::..|..|             ....
Mosquito   155 TTIAGWGQTGQ------STGEV-VPV------RRLLYFRARVITNTSCLVSFPLYLSSRNVCTST 206

  Fly   256 EQGGKDSCQGDSGGPMHVLGSGDAYQLAGIVSWG--EGCAKPNAPGVYTRVGSFNDWIAENTRDA 318
            |.|.  :|.||.|||:.|..:|....:| :.|:|  .||.: :.|.|:|||..:..|| ||..||
Mosquito   207 ENGA--ACVGDEGGPVTVTENGQTILIA-VHSYGFSMGCER-SWPSVHTRVTEYLTWI-ENNSDA 266

  Fly   319  318
            Mosquito   267  266

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18735NP_652645.1 Tryp_SPc 82..311 CDD:214473 72/251 (29%)
Tryp_SPc 83..314 CDD:238113 73/253 (29%)
AgaP_AGAP005702XP_001688712.1 Tryp_SPc 32..260 CDD:214473 72/251 (29%)
Tryp_SPc 33..263 CDD:238113 74/254 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.