DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18735 and AgaP_AGAP006485

DIOPT Version :9

Sequence 1:NP_652645.1 Gene:CG18735 / 59137 FlyBaseID:FBgn0042098 Length:364 Species:Drosophila melanogaster
Sequence 2:XP_001688885.1 Gene:AgaP_AGAP006485 / 5667297 VectorBaseID:AGAP006485 Length:281 Species:Anopheles gambiae


Alignment Length:299 Identity:74/299 - (24%)
Similarity:131/299 - (43%) Gaps:60/299 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    52 ILGPEVPAEWSSPAKRECAECSCGNINTRHRIVGGQETEVHEYPWMIMLMWFGNFYCGASLVNDQ 116
            |.|..|.:|..||                 |::||......::|..:.:....|.:||.::|:.|
Mosquito    17 IRGDNVESEDRSP-----------------RLIGGTNAPWGQFPSAVSINTTFNVHCGGAVVDRQ 64

  Fly   117 YALTAAHCVNGFYHRL-----ITVRLLEHNRQDSHVKIVDRRVSRVLIHPKYSTRNFDSDIALIR 176
            :.||||.||.....||     ||||..:........:...|:||.:.:||:::.|..:.|:|::|
Mosquito    65 HVLTAAQCVFNANLRLVDPYWITVRAGDIALAPVGARRQTRKVSHIFVHPQFNIRTLEHDVAVLR 129

  Fly   177 FNEPVRLGIDMHPVCMPTPSENYAGQTAVV---------TGWGALSE--GGPISDTLQEVEVPIL 230
            .:.|..|         |:.:.|.|.:|..:         .||||.:.  ..|::...:.:.:.:.
Mosquito   130 LDRPYDL---------PSNTINLANRTRRIVPNGASCQFAGWGASTAALNAPVNVLQRFLPMTVN 185

  Fly   231 SQEECRNSNYGESKITDNMICAGYVEQGGKDS---CQGDSGGPMHVLGSGDAYQLAGIVSWGEGC 292
            .::.|..:|....::.::.:|||  ..||.::   |.|::|..::.     ...|.|.:|:|..|
Mosquito   186 DRDMCNQANMHAGRMLESHLCAG--NTGGSNNAAPCNGNAGTGLYC-----ERALVGTLSFGLNC 243

  Fly   293 AKPNAPGVYTRVGSFNDWIAENTRDACSCAQPEAAGEPA 331
            ...|.|.|:|:|..:||||.....        :..|:||
Mosquito   244 GAANNPPVFTQVRFYNDWIERQFN--------QTQGQPA 274

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18735NP_652645.1 Tryp_SPc 82..311 CDD:214473 63/247 (26%)
Tryp_SPc 83..314 CDD:238113 64/249 (26%)
AgaP_AGAP006485XP_001688885.1 Tryp_SPc 30..262 CDD:214473 63/247 (26%)
Tryp_SPc 32..265 CDD:238113 64/248 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.