DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18735 and AgaP_AGAP006673

DIOPT Version :9

Sequence 1:NP_652645.1 Gene:CG18735 / 59137 FlyBaseID:FBgn0042098 Length:364 Species:Drosophila melanogaster
Sequence 2:XP_001688952.1 Gene:AgaP_AGAP006673 / 5667010 VectorBaseID:AGAP006673 Length:307 Species:Anopheles gambiae


Alignment Length:329 Identity:84/329 - (25%)
Similarity:152/329 - (46%) Gaps:51/329 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 LILATALGDLACATPSLRSA--SDPEKILNNLAQL-----RQSSFLDWIQSILGPEVPAEWSSPA 65
            |:.|.||..|.....|.||.  .||.:: .::.:.     |..:.|.:::::..|          
Mosquito     3 LVAAFALVGLLATLASARSLLDIDPARV-KSIEEYDRYWRRLPAELQYLRTVEQP---------- 56

  Fly    66 KRECAECSCGNINTRHRIVGGQETEVHEYPWM-IMLMWFGNFY---CGASLVNDQYALTAAHCVN 126
                         || ||..||.....::|:. ::....|:.|   ||.:::...|.|||||||.
Mosquito    57 -------------TR-RITNGQLATAGQFPYQAVVYSEAGDGYYSLCGGTILTTTYVLTAAHCVT 107

  Fly   127 GFYHRLITVRLLEHNRQDSHV-KIVDRRVS----RVLIHPKYSTRNFDSDIALIRFNEPVRLGID 186
            ..:.|.:|..::.....|..| :...:|:|    .:.:||:|::.:..:|||.:|.:........
Mosquito   108 DDFDRAVTGGIVFLGATDRTVFQSTQQRMSFGNAGIRVHPQYNSTSIRNDIATVRLDTAAIFNTY 172

  Fly   187 MHPVCMPTPSE--NYAGQTAVVTGWGALSEGGP-ISDTLQEVEVPILSQEECRNSNYGESKITDN 248
            :..:.:|..|:  .:.|.....:|:|..::..| .|:.|..|..|:::..:| |:.:..:.:...
Mosquito   173 VKAIDLPALSDARQFGGFEGTASGFGRTADTVPAASNVLMFVRNPVMTNAQC-NAYWSTAVVQAQ 236

  Fly   249 MICAGYVEQGGKDSCQGDSGGPMHVLGSGDAYQLAGIVSW--GEGCAKPNAPGVYTRVGSFNDWI 311
            .:|..  ..||:.:|.||||||:.|..:|.:.|: ||.|:  ..||.. .||.|:.||..|.|:|
Mosquito   237 NVCLD--PYGGRSACHGDSGGPLAVQDAGRSLQV-GIASFVSANGCTS-GAPSVWVRVSYFRDFI 297

  Fly   312 AENT 315
            ::|:
Mosquito   298 SQNS 301

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18735NP_652645.1 Tryp_SPc 82..311 CDD:214473 67/242 (28%)
Tryp_SPc 83..314 CDD:238113 67/244 (27%)
AgaP_AGAP006673XP_001688952.1 Tryp_SPc 59..297 CDD:214473 67/242 (28%)
Tryp_SPc 60..300 CDD:238113 67/244 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.