DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18735 and AgaP_AGAP005597

DIOPT Version :9

Sequence 1:NP_652645.1 Gene:CG18735 / 59137 FlyBaseID:FBgn0042098 Length:364 Species:Drosophila melanogaster
Sequence 2:XP_001688690.1 Gene:AgaP_AGAP005597 / 5666842 VectorBaseID:AGAP005597 Length:275 Species:Anopheles gambiae


Alignment Length:251 Identity:58/251 - (23%)
Similarity:92/251 - (36%) Gaps:60/251 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    88 ETEVHEYPWMIMLMWFGNFYCGASLVNDQYALTAAH-CVNGFYHRLITVR----LLEHNRQDSHV 147
            |:|:..|..:          |..:|:...|.|:... |:.  ...:.|:|    :|..|:.:...
Mosquito    68 ESELSNYTRL----------CDGALITSNYILSVTQGCLQ--VGSMQTIRNGTAILAFNKNNWEQ 120

  Fly   148 KIVDRRVSRVLIHPKYSTRNFDSDIALIRFNEPVRLGIDMHPVCMP--TPSENYAGQTAVVTGWG 210
            :|.... |.:.:||..|       |.|:|.:.|..|...:..:.:|  |.|.:|.|.        
Mosquito   121 RITFSG-SAINLHPYKS-------IGLVRLDYPATLNEHVQLIRLPKLTDSRSYEGM-------- 169

  Fly   211 ALSEGGPISDTLQEVEVPILSQEECRNSNYGESKITDNMICAG-YVEQGGKDSCQGDSGGPM--- 271
               ||...:.....|...::|...| :....:...||..||.. |:   |...|....|..:   
Mosquito   170 ---EGTTSNQYRSYVRNRVMSNAHC-SQERPDFNATDMDICTDRYI---GGAFCSTSLGSSLTIE 227

  Fly   272 ---HVLGSGDAYQLAGIVSWGEGCAKPNAPGVYTRVGSFNDWIAENTR---DACSC 321
               .|:..|.||::.        ....|.|.||.||.||.|||..|:.   :.|:|
Mosquito   228 DENGVILIGLAYRIY--------YCDYNYPTVYARVSSFRDWIHNNSDYKFEHCTC 275

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18735NP_652645.1 Tryp_SPc 82..311 CDD:214473 53/236 (22%)
Tryp_SPc 83..314 CDD:238113 55/239 (23%)
AgaP_AGAP005597XP_001688690.1 Tryp_SPc 48..265 CDD:304450 55/239 (23%)
Tryp_SPc 48..262 CDD:214473 53/236 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.