DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18735 and AgaP_AGAP005596

DIOPT Version :9

Sequence 1:NP_652645.1 Gene:CG18735 / 59137 FlyBaseID:FBgn0042098 Length:364 Species:Drosophila melanogaster
Sequence 2:XP_001688689.1 Gene:AgaP_AGAP005596 / 5666841 VectorBaseID:AGAP005596 Length:266 Species:Anopheles gambiae


Alignment Length:243 Identity:53/243 - (21%)
Similarity:98/243 - (40%) Gaps:46/243 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    93 EYPWMIMLMWFGNFYCGASLVNDQYALTAAH-CVNGFYHRLITVRLLEHN------RQDSHVKIV 150
            ::|::..:...| ..|..:|:...|.::.|. |:|     ..|::..::.      .::...:.:
Mosquito    56 QFPYLTFIENNG-VVCNGALITPNYIVSVARGCLN-----RSTIKTAQYGTAILAFNKNMWEQRI 114

  Fly   151 DRRVSRVLIHPKYSTRNFDSDIALIRFNEPVRLGIDMHPVCMP--TPSENYAGQTAVVTGWGALS 213
            :...|.:.:||.       .||||.|.|.|..|...:.|:.:|  :.|.:|...           
Mosquito   115 NFSASAINLHPY-------EDIALARLNYPATLNKHVQPIRLPKLSDSRSYVDM----------- 161

  Fly   214 EGGPISDTLQEVEVPILSQEEC--RNSNYGESKITDNMICAGYVEQGGKDSCQGDSGGPMHVLGS 276
            ||..:: |.:.|...::|..||  .:.|:..:.:.   ||....:.|.  .|....|.|: .:..
Mosquito   162 EGTTVA-TNRYVRNRVMSNAECTKEHPNFNATHVD---ICTDRYKGGA--FCSFFLGSPL-TIED 219

  Fly   277 GDAYQLAGIVSWGEGCAKPNAPGVYTRVGSFNDWIAENTR---DACSC 321
            .:...|.|:.:|...|.. |.|..|.|:..|.|||..|:.   :.|:|
Mosquito   220 ENGVILIGLANWISSCDN-NYPTGYARILPFRDWIHNNSDYKFEHCTC 266

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18735NP_652645.1 Tryp_SPc 82..311 CDD:214473 48/228 (21%)
Tryp_SPc 83..314 CDD:238113 50/231 (22%)
AgaP_AGAP005596XP_001688689.1 Tryp_SPc 54..256 CDD:304450 50/231 (22%)
Tryp_SPc 54..253 CDD:214473 48/228 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.