DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18735 and si:dkey-33m11.7

DIOPT Version :9

Sequence 1:NP_652645.1 Gene:CG18735 / 59137 FlyBaseID:FBgn0042098 Length:364 Species:Drosophila melanogaster
Sequence 2:XP_021335658.1 Gene:si:dkey-33m11.7 / 565163 ZFINID:ZDB-GENE-141216-115 Length:214 Species:Danio rerio


Alignment Length:232 Identity:75/232 - (32%)
Similarity:107/232 - (46%) Gaps:61/232 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly    99 MLMWFGNFYCGASLVNDQYALTAAHCVNGFYHRLITVRLLEHNRQDSHVKIVDRRVSRVLIHPKY 163
            |::..|::..||:...:||:                                  :...::.||.|
Zfish     4 MMVVAGDYTLGANEGTEQYS----------------------------------KPLMLIPHPLY 34

  Fly   164 STRNFDSDIALIRFNEPVRLGIDMHPVCMPTPSEN---YAGQTAVVTGWGALS-EGGPISDTLQE 224
            :....::||.||:.:.|:.|  :.:....|.|.:|   .||:...|:|||:.| .||.|..||:.
Zfish    35 NRSTNNADIMLIKLSAPIEL--NRYVSLAPLPKQNTGLLAGRMCRVSGWGSTSHSGGLIPLTLRT 97

  Fly   225 VEVPILSQEECRNSNYGESKITDNMICAGYVEQGGKDS---------------CQGDSGGPMHVL 274
            |.:||:|..:|.:|:.....||.|||||| ...||||:               ||||||||:  :
Zfish    98 VRLPIVSTFKCNSSSSFSGNITANMICAG-SSTGGKDACKNSTQYLCHLIVYLCQGDSGGPL--V 159

  Fly   275 GSGDAYQLAGIVSWGEGCAKPNAPGVYTRVGSFNDWI 311
            ..|..|   |:||||.||..|..|||||.|..|..||
Zfish   160 CDGRVY---GLVSWGNGCGDPRFPGVYTAVSRFRRWI 193

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18735NP_652645.1 Tryp_SPc 82..311 CDD:214473 73/230 (32%)
Tryp_SPc 83..314 CDD:238113 75/232 (32%)
si:dkey-33m11.7XP_021335658.1 Tryp_SPc <2..196 CDD:238113 75/232 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.