DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18735 and LOC562139

DIOPT Version :9

Sequence 1:NP_652645.1 Gene:CG18735 / 59137 FlyBaseID:FBgn0042098 Length:364 Species:Drosophila melanogaster
Sequence 2:NP_001075159.1 Gene:LOC562139 / 562139 -ID:- Length:263 Species:Danio rerio


Alignment Length:235 Identity:87/235 - (37%)
Similarity:126/235 - (53%) Gaps:16/235 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly    82 RIVGGQETEVHEYPWMIMLMWFGNF-YCGASLVNDQYALTAAHCVNGFYHRLITVRLLEHNRQDS 145
            |||.|:|...|.:||.:.|.....| :||.||:|:.:.:|||||.....||:|   |.||:|..:
Zfish    33 RIVNGEEAVPHSWPWQVSLQDSTGFHFCGGSLINEWWVVTAAHCNVRTSHRVI---LGEHDRSSN 94

  Fly   146 HVKIVDRRVSRVLIHPKYSTRNFDSDIALIRFNEPVRLGIDMHPVCMPTPSENY-AGQTAVVTGW 209
            ...|....|.:|..||.::....::||.||:...|.::...:.|||:...::|: .|...|.:||
Zfish    95 AEPIQTMTVGKVFKHPNFNMFTINNDILLIKLATPAKINTHVSPVCLAETNDNFPGGMKCVTSGW 159

  Fly   210 GALSEGGPISDT---LQEVEVPILSQEECRNSNYGESKITDNMICAGYVEQGGKDSCQGDSGGPM 271
            |......|  ||   ||:..:|:|:.|:|:  .:..:||||.|:|||   ..|..||.||||||:
Zfish   160 GLTKHNAP--DTPALLQQAALPLLTNEDCK--RFWGNKITDLMVCAG---ASGASSCMGDSGGPL 217

  Fly   272 HVLGSGDAYQLAGIVSWGEGCAKPNAPGVYTRVGSFNDWI 311
             |......:.|.||||||......::||||.||.....|:
Zfish   218 -VCQKDGVWTLVGIVSWGSSVCSTSSPGVYARVTKLRAWV 256

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18735NP_652645.1 Tryp_SPc 82..311 CDD:214473 86/233 (37%)
Tryp_SPc 83..314 CDD:238113 86/234 (37%)
LOC562139NP_001075159.1 Tryp_SPc 33..256 CDD:214473 86/233 (37%)
Tryp_SPc 34..259 CDD:238113 86/234 (37%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100031
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.