DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18735 and tmprss9

DIOPT Version :9

Sequence 1:NP_652645.1 Gene:CG18735 / 59137 FlyBaseID:FBgn0042098 Length:364 Species:Drosophila melanogaster
Sequence 2:XP_021325244.1 Gene:tmprss9 / 562051 ZFINID:ZDB-GENE-050208-573 Length:788 Species:Danio rerio


Alignment Length:352 Identity:118/352 - (33%)
Similarity:177/352 - (50%) Gaps:56/352 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    32 KILNNLAQLRQSSF-LDWIQSILGPEVPAEWSSPAKRECAE------CSCGNINTR----HRIVG 85
            :|.|::::...|:| .|..:.|..|....::.:    :|.:      ||||   ||    :||||
Zfish   177 EIGNDISKCPDSTFTCDNGECITKPNPECDYIT----DCTDGSDETFCSCG---TRPVMSNRIVG 234

  Fly    86 GQETEVHEYPWMIMLMWFGNFYCGASLVNDQYALTAAHCVNGFYHRLITVRLLEHNRQDSHVKIV 150
            |:.|...|:||.:.|...|...||||:||.::.::||||..           :|:|.:|....:.
Zfish   235 GENTRHGEFPWQVSLRLRGRHTCGASIVNSRWLVSAAHCFE-----------VENNPKDWTALVG 288

  Fly   151 DRRVS------------RVLIHPKYSTRNFDSDIALIRFNEPVRLGIDMHPVCMPTPSENYA-GQ 202
            ..:||            .:::.|||.....|||:.::....|::....:.|||:|:.|..:. ||
Zfish   289 ANQVSGAEAEAFIVNIKSLVMSPKYDPMTTDSDVTVLELETPLKFSHYVQPVCIPSSSHVFTPGQ 353

  Fly   203 TAVVTGWGALSE-GGPISDTLQEVEVPILSQEECRNSNYGESKITDNMICAGYVEQGGKDSCQGD 266
            ..:|:|||||:: ...:..|||:..|.|:..:.|..|:.....:|.||:|||:: ||..||||||
Zfish   354 NCIVSGWGALNQYTTEVPSTLQKAIVKIIDSKVCNKSSVYRGALTQNMMCAGFL-QGKVDSCQGD 417

  Fly   267 SGGPMHVLGSGDAYQLAGIVSWGEGCAKPNAPGVYTRVGSFNDWIAENTRDACSCAQPEAAGEPA 331
            ||||:....:...|.||||||||.|||:.|.||||:||....:||...|:.|     |.....|.
Zfish   418 SGGPLACEVAAGRYFLAGIVSWGVGCAQINKPGVYSRVTKLRNWIVSYTKTA-----PAFQENPT 477

  Fly   332 SPMETTEQGDQENTTANGAAEADPEVE 358
            .|..||       |.|:....|:|..|
Zfish   478 VPSVTT-------TEAHHVKAANPSSE 497

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18735NP_652645.1 Tryp_SPc 82..311 CDD:214473 90/242 (37%)
Tryp_SPc 83..314 CDD:238113 91/244 (37%)
tmprss9XP_021325244.1 SEA 52..146 CDD:307516
LDLa 185..220 CDD:238060 6/38 (16%)
Tryp_SPc 232..462 CDD:238113 89/241 (37%)
LDLa 510..544 CDD:238060
Tryp_SPc 557..783 CDD:238113
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100031
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.