DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18735 and zgc:112285

DIOPT Version :9

Sequence 1:NP_652645.1 Gene:CG18735 / 59137 FlyBaseID:FBgn0042098 Length:364 Species:Drosophila melanogaster
Sequence 2:NP_001020685.1 Gene:zgc:112285 / 561476 ZFINID:ZDB-GENE-050913-132 Length:316 Species:Danio rerio


Alignment Length:342 Identity:103/342 - (30%)
Similarity:149/342 - (43%) Gaps:69/342 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 FHLLLILATALGDLACATPSLRSASDPEKILNNLAQLRQSSFLDWIQSILGPEVPAEWSSPAKRE 68
            |.|||:|...:.|.|.......|.....|||:          |||      |:            
Zfish     8 FALLLLLLGLVLDRASTHAFNPSRLQQHKILH----------LDW------PK------------ 44

  Fly    69 CAECSCGNI--NTRHRIVGGQETEVHEYPWMIMLM---WFGNFY---CGASLVNDQYALTAAHCV 125
              :|...:.  ||..|||.|.|...|.:||.:.|.   .....|   ||.:|::..:.||||||.
Zfish    45 --DCGLAHFKPNTVERIVSGNEARPHSWPWQVSLQVRPRGSKHYVHVCGGTLIHKNWVLTAAHCF 107

  Fly   126 -NGFYHRLITVRLLEHNRQDSHVKIVDR--RVSRVLIH-----PKYSTRNFDSDIALIRFNEPVR 182
             .|......:.|::....|....:..:|  .|.|:..|     |.:|  ..|.||||      |:
Zfish   108 QKGKAEDASSWRIVLGKHQLKRSETAERFFPVKRIYRHEHFRYPAHS--ELDYDIAL------VK 164

  Fly   183 LGIDMHP------VCMPTPSENY-AGQTAVVTGWGALSEGG----PISDTLQEVEVPILSQEECR 236
            ...|:.|      .|:|....|. .|....|||||. :.||    .:::.|.:..:||:..:.||
Zfish   165 AATDIQPSNFIRYACLPRKQINLNPGHYCWVTGWGD-TRGGKENVSLAEALNQARLPIIDYKTCR 228

  Fly   237 NSNYGESKITDNMICAGYVE-QGGKDSCQGDSGGPMHVLGSGDAYQLAGIVSWGE-GCAKPNAPG 299
            ...:...::.|:|||||:.: :|...:||||||||:......|.:::.||||:|. ||...|.|.
Zfish   229 QKKFWGDRVRDSMICAGFRDTEGTPAACQGDSGGPLLCQVGRDRWEVHGIVSFGPIGCTVENKPS 293

  Fly   300 VYTRVGSFNDWIAENTR 316
            |:||..::..|| |.||
Zfish   294 VFTRTAAYIPWI-EATR 309

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18735NP_652645.1 Tryp_SPc 82..311 CDD:214473 80/255 (31%)
Tryp_SPc 83..314 CDD:238113 81/257 (32%)
zgc:112285NP_001020685.1 Tryp_SPc 58..305 CDD:214473 80/255 (31%)
Tryp_SPc 59..308 CDD:238113 82/258 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D380103at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.