DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18735 and masp2

DIOPT Version :9

Sequence 1:NP_652645.1 Gene:CG18735 / 59137 FlyBaseID:FBgn0042098 Length:364 Species:Drosophila melanogaster
Sequence 2:NP_001116330.1 Gene:masp2 / 560277 ZFINID:ZDB-GENE-060130-154 Length:684 Species:Danio rerio


Alignment Length:261 Identity:95/261 - (36%)
Similarity:141/261 - (54%) Gaps:29/261 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    74 CGNINTR-HRIVGGQETEVHEYPWMIMLMWFGNFYCGASLVNDQYALTAAHCVNGFYH------R 131
            ||....: .:::||:..|.:|.||.:|:.....|..||||::|.:.|||||.|..|..      |
Zfish   426 CGQPELKLSKVIGGENAEKNEIPWQVMIRMGTKFIGGASLLSDGWVLTAAHVVKSFEDSANLQLR 490

  Fly   132 LITVRLLEHNRQDSHVKIVDRRVSRVLIHPKY--STRNFDSDIALIRFNEPVRLGIDMHPVCMPT 194
            :.||:   |:..::.|.|    ..::.|||:|  ...||:.|||||:....|.:...:.|||:|.
Zfish   491 MGTVK---HHDNEAVVGI----PQKIFIHPQYHHDNVNFNHDIALIKLEYKVPVSKAVMPVCLPG 548

  Fly   195 PSENY---AGQTAVVTGWGALSEGGP--ISDTLQEVEVPILSQEECRN------SNYGESKITDN 248
            ..|.:   |.....|:|||..:...|  .|..|:.|.:|:.:..:|:.      ::.|:..:|:|
Zfish   549 REERFVLKANDVGKVSGWGVSNINTPALFSGNLKYVHLPVSNFNDCKTKYDSTVTSKGKLVVTEN 613

  Fly   249 MICAGYVEQGGKDSCQGDSGGPMHVLG-SGDAYQLAGIVSWGEGCAKPNAPGVYTRVGSFNDWIA 312
            |||||: .||||||||||||||..... ...::.:.||||||.|||:....||||:|.::..||.
Zfish   614 MICAGF-SQGGKDSCQGDSGGPFAFFDKQSKSWFIGGIVSWGHGCAQAGYYGVYTKVSNYLSWIE 677

  Fly   313 E 313
            |
Zfish   678 E 678

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18735NP_652645.1 Tryp_SPc 82..311 CDD:214473 90/248 (36%)
Tryp_SPc 83..314 CDD:238113 93/251 (37%)
masp2NP_001116330.1 CUB 24..130 CDD:214483
EGF_CA 134..176 CDD:214542
CUB 180..289 CDD:278839
CCP 296..357 CDD:214478
CCP 362..410 CDD:153056
Tryp_SPc 435..676 CDD:214473 90/248 (36%)
Tryp_SPc 436..679 CDD:238113 93/251 (37%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.