DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18735 and tmprss13a

DIOPT Version :9

Sequence 1:NP_652645.1 Gene:CG18735 / 59137 FlyBaseID:FBgn0042098 Length:364 Species:Drosophila melanogaster
Sequence 2:NP_001152984.1 Gene:tmprss13a / 559754 ZFINID:ZDB-GENE-090309-3 Length:506 Species:Danio rerio


Alignment Length:251 Identity:87/251 - (34%)
Similarity:135/251 - (53%) Gaps:19/251 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly    71 ECS-CGNINTRHRIVGGQETEVHEYPWMIMLMWFGNFYCGASLVNDQYALTAAHCVNGFYHRLIT 134
            :|| ||...:..||:||..:|:.:|||.:.|.:.....||.:|::..:.::||||..|       
Zfish   256 QCSDCGKQQSSSRIIGGTTSELGQYPWQVSLHYNKAHVCGGTLISPDFIVSAAHCFQG------- 313

  Fly   135 VRLLEHNRQDSHVKIVDRR-------VSRVLIHPKYSTRNFDSDIALIRFNEPVRLGIDMHPVCM 192
             ::........:|.||.::       |.::::..||::...|:|:||:..:.||.......|||:
Zfish   314 -KMANSAYWLVYVGIVSQQSLGMPYLVKKIIVSEKYNSDTNDNDVALLILSRPVAFSYTTQPVCL 377

  Fly   193 PTPSENYAGQTAVVT-GWGALSEGGP-ISDTLQEVEVPILSQEECRNSNYGESKITDNMICAGYV 255
            ||.::.::|.....| |:|...:|.. .|.:|..|.|.|:....|.:.......||:||||||.:
Zfish   378 PTFNQTFSGGLQCWTSGFGTTKQGADRASSSLMSVSVNIIDSSVCNSCQIYCGLITNNMICAGDL 442

  Fly   256 EQGGKDSCQGDSGGPMHVLGSGDAYQLAGIVSWGEGCAKPNAPGVYTRVGSFNDWI 311
             :||:||||||||||:......:.:.|.||.|||.||.:...||||:||.||..||
Zfish   443 -KGGRDSCQGDSGGPLVCKDDNNRWYLVGITSWGAGCGQKQKPGVYSRVTSFLPWI 497

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18735NP_652645.1 Tryp_SPc 82..311 CDD:214473 81/237 (34%)
Tryp_SPc 83..314 CDD:238113 82/238 (34%)
tmprss13aNP_001152984.1 SRCR_2 178..261 CDD:295335 2/4 (50%)
Tryp_SPc 268..497 CDD:214473 81/237 (34%)
Tryp_SPc 269..497 CDD:238113 80/236 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - mtm6379
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X11
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
43.910

Return to query results.
Submit another query.