DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18735 and zgc:112038

DIOPT Version :9

Sequence 1:NP_652645.1 Gene:CG18735 / 59137 FlyBaseID:FBgn0042098 Length:364 Species:Drosophila melanogaster
Sequence 2:NP_001018482.1 Gene:zgc:112038 / 553673 ZFINID:ZDB-GENE-050522-271 Length:311 Species:Danio rerio


Alignment Length:252 Identity:93/252 - (36%)
Similarity:139/252 - (55%) Gaps:14/252 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly    69 CAECSCGNINTRHRIVGGQETEVHEYPWMIMLMWFG--NFYCGASLVNDQYALTAAHCVNGFYHR 131
            |.:....|.|      ||.:.....:||...:....  :..||.||:|..:.|:||||.......
Zfish    27 CGQAPLNNNN------GGDDAVAGSWPWQASIHRISPEDHICGGSLINKDWVLSAAHCFMITATA 85

  Fly   132 LITVRLLEHNRQDSHVKIVDRRVSRVLIHPKYSTRNFDSDIALIRFNEPVRLGIDMHPVCMPTPS 196
            .|.:.|....:..|:...:.|.:::::|||.|||...::||||:|.:..|.....:.|||:.:..
Zfish    86 NIKIFLGRQFQTGSNPNEISRTLTQIVIHPDYSTTTQNNDIALLRLSSSVTFTDYIRPVCLASAD 150

  Fly   197 ENYAGQT-AVVTGWGA-LSEGGPISDTLQEVEVPILSQEECRNSNYGESKITDNMICAGYVEQGG 259
            ..:||.| :.:|||.. .|....:::.||||::|::|..|| |::| :..||||||||| :.:||
Zfish   151 SVFAGGTKSWITGWDKHRSSDIQVTNVLQEVQLPVVSNTEC-NADY-KGIITDNMICAG-INEGG 212

  Fly   260 KDSCQGDSGGPMHVLGSGDAYQLAGIVSWGEGCAKPNAPGVYTRVGSFNDWIAENTR 316
            ||:||||||||| |..:|..:..:||||:|..|..|..||:||||..:..||....|
Zfish   213 KDACQGDSGGPM-VSQNGSRWIQSGIVSFGRECGLPRYPGIYTRVSQYQSWITSELR 268

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18735NP_652645.1 Tryp_SPc 82..311 CDD:214473 87/232 (38%)
Tryp_SPc 83..314 CDD:238113 89/234 (38%)
zgc:112038NP_001018482.1 Tryp_SPc 37..263 CDD:214473 87/229 (38%)
Tryp_SPc 37..263 CDD:238113 87/229 (38%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170587784
Domainoid 1 1.000 191 1.000 Domainoid score I3175
eggNOG 1 0.900 - - E33208_3BJ04
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 201 1.000 Inparanoid score I3731
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D380103at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - mtm6349
orthoMCL 1 0.900 - - OOG6_100031
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X11
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
98.700

Return to query results.
Submit another query.