DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18735 and cfd

DIOPT Version :9

Sequence 1:NP_652645.1 Gene:CG18735 / 59137 FlyBaseID:FBgn0042098 Length:364 Species:Drosophila melanogaster
Sequence 2:NP_001018368.1 Gene:cfd / 553553 ZFINID:ZDB-GENE-050522-411 Length:249 Species:Danio rerio


Alignment Length:249 Identity:79/249 - (31%)
Similarity:118/249 - (47%) Gaps:38/249 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    83 IVGGQETEVHEYPWMIMLMWFGNFYCGASLVNDQYALTAAHCVNGFYHRLITVRLLEHNRQDSHV 147
            |.||||.:.|..|:|..:.|.|...||..|::.|:.::||||.              .:.:.|.|
Zfish    21 ITGGQEAKAHSRPYMASVQWNGKHECGGFLISSQWVMSAAHCF--------------QDGRTSGV 71

  Fly   148 KIV----------DRRV---SRVLIHPKYSTRNFDSDIALIRFNEPVRLGIDMHPVCMPTPSENY 199
            |:|          |.:.   :.|..||.:|..|:|:|||||:.::||.....:.||.........
Zfish    72 KVVLGAHSLSGAEDTKQTFDAEVYNHPDFSISNYDNDIALIKLDKPVTQSDAVKPVKFQRDETAD 136

  Fly   200 AGQTAVV--TGWGALSEGGPISDTLQEVEVPILSQEECRNSNYGESKITDNMICAGYVEQGGKDS 262
            ..:.|||  .|||:|:..|...|.|.|:.:|::.:..|..:::...|.|.||:||.   ...||:
Zfish   137 PKEAAVVETAGWGSLNNMGGRPDKLHELSIPVMERWRCGRADFYGEKFTSNMLCAA---DKRKDT 198

  Fly   263 CQGDSGGPMHVLGSGDAYQLAGIVS-WGEGCAKPNAPGVYTRVGSFNDWIAENT 315
            |.||||||:...|.     :.||.| .|:.|.....||:||.:..:..||...|
Zfish   199 CDGDSGGPLLYRGI-----VVGITSNGGKKCGSSRKPGLYTIISHYASWIDTTT 247

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18735NP_652645.1 Tryp_SPc 82..311 CDD:214473 76/243 (31%)
Tryp_SPc 83..314 CDD:238113 78/246 (32%)
cfdNP_001018368.1 Tryp_SPc 21..246 CDD:238113 78/246 (32%)
Tryp_SPc 21..243 CDD:214473 76/243 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.