DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18735 and habp2

DIOPT Version :9

Sequence 1:NP_652645.1 Gene:CG18735 / 59137 FlyBaseID:FBgn0042098 Length:364 Species:Drosophila melanogaster
Sequence 2:NP_001103843.2 Gene:habp2 / 553472 ZFINID:ZDB-GENE-030131-4721 Length:546 Species:Danio rerio


Alignment Length:292 Identity:92/292 - (31%)
Similarity:145/292 - (49%) Gaps:49/292 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    55 PEVPAEWSSPAKRECAECSCGNIN-TRHRIVGGQETEVHEYPWMIMLMWFGNFY----------- 107
            ||.|.  ::|.|.|.::|.....: ...||.||:::....:||.      .:|.           
Zfish   276 PEKPL--TTPTKLEFSDCGKAAFSMIAPRIFGGRKSLPEAHPWQ------ASFQVRPKGSNATFE 332

  Fly   108 --CGASLVNDQYALTAAHCVNGFYHRLITVRLLEHNRQDSHVKIVDRRVSRVLIHPKYSTRNFD- 169
              ||.:|::..:.||||||::......:.:..:...:.|...:.|:  |.::::|..| |..|| 
Zfish   333 HNCGGTLIDSCWILTAAHCIDENDEVRVELGGVNLEKDDPDKQFVE--VEKIIVHENY-TETFDA 394

  Fly   170 --SDIALIRF--------NEPVRLGIDMHPVCMPT---PSENYAGQTAVVTGWGALSEGGPISDT 221
              :||||::.        ||    ...:...|:||   |.    |....::|:||..:...:|..
Zfish   395 LYNDIALLKLKGRNGRCANE----SRSVRAACLPTDLFPE----GTRCTISGYGATEKHHGVSTQ 451

  Fly   222 LQEVEVPILSQEECRNSNYGESKITDNMICAGYVEQGGKDSCQGDSGGPMHVLGSGDAYQLAGIV 286
            |.:.:|.::||..|.:.|...:::.|:|:||||: ||..||||||||||: |....:.:.:.|:|
Zfish   452 LLDAKVLLISQSRCMSRNVYGNRMDDSMMCAGYM-QGKIDSCQGDSGGPL-VCKKDNIHYIYGVV 514

  Fly   287 SWGEGCAKPNAPGVYTRVGSFNDWIAENTRDA 318
            |||:.|.|.|.||||.||..|.|||.|..|.|
Zfish   515 SWGDSCGKKNKPGVYARVTKFIDWINEKMRTA 546

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18735NP_652645.1 Tryp_SPc 82..311 CDD:214473 80/255 (31%)
Tryp_SPc 83..314 CDD:238113 81/257 (32%)
habp2NP_001103843.2 EGF_CA 80..112 CDD:238011
EGF_CA 158..190 CDD:238011
KR 195..273 CDD:214527
Tryp_SPc 302..539 CDD:214473 80/255 (31%)
Tryp_SPc 303..542 CDD:238113 81/257 (32%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.