DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18735 and ctrb.3

DIOPT Version :9

Sequence 1:NP_652645.1 Gene:CG18735 / 59137 FlyBaseID:FBgn0042098 Length:364 Species:Drosophila melanogaster
Sequence 2:NP_001017724.1 Gene:ctrb.3 / 550419 ZFINID:ZDB-GENE-050417-229 Length:265 Species:Danio rerio


Alignment Length:235 Identity:99/235 - (42%)
Similarity:137/235 - (58%) Gaps:14/235 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly    82 RIVGGQETEVHEYPWMIMLMWFGNF-YCGASLVNDQYALTAAHCVNGFYHRLITVRLLEHNRQDS 145
            |||.|:|...|.:||.:.|..|..| :||.||:|:.:.:|||||.....||:|   |.|||:..|
Zfish    33 RIVNGEEAVPHSWPWQVSLQDFTGFHFCGGSLINEFWVVTAAHCSVRTSHRVI---LGEHNKGKS 94

  Fly   146 HVK--IVDRRVSRVLIHPKYSTRNFDSDIALIRFNEPVRLGIDMHPVCMPTPSENYA-GQTAVVT 207
            :.:  |...:||:|..||:|::...::||||::...|..|...:.|||:...|:|:| |.|.|.:
Zfish    95 NTQEDIQTMKVSKVFTHPQYNSNTIENDIALVKLTAPASLNAHVSPVCLAEASDNFASGMTCVTS 159

  Fly   208 GWGALSEGGPIS-DTLQEVEVPILSQEECRNSNYGESKITDNMICAGYVEQGGKDSCQGDSGGPM 271
            |||........: |.||:|.:|:||.|:|:| ::| |.|.|.|||||   ..|..||.||||||:
Zfish   160 GWGVTRYNALFTPDELQQVALPLLSNEDCKN-HWG-SNIRDTMICAG---AAGASSCMGDSGGPL 219

  Fly   272 HVLGSGDAYQLAGIVSWGEGCAKPNAPGVYTRVGSFNDWI 311
             |....:.:.|.||||||.....|..||||.||....||:
Zfish   220 -VCQKDNIWTLVGIVSWGSSRCDPTMPGVYGRVTELRDWV 258

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18735NP_652645.1 Tryp_SPc 82..311 CDD:214473 98/233 (42%)
Tryp_SPc 83..314 CDD:238113 98/234 (42%)
ctrb.3NP_001017724.1 Tryp_SPc 33..258 CDD:214473 98/233 (42%)
Tryp_SPc 34..261 CDD:238113 98/234 (42%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100031
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.